Questo sito utilizza cookie, anche di terze parti, per migliorare la tua esperienza e offrire servizi in linea con le tue preferenze. Chiudendo questo banner, scorrendo questa pagina o cliccando qualunque suo elemento acconsenti all’uso dei cookie. Se vuoi saperne di più o negare il consenso a tutti o ad alcuni cookie vai alla sezione.

Chi sono io? Nan yar?
Traduzione di Dr. T. M. P. MAHADEVAN dall'originale Tamil.

Pubblicato da V. S. RAMANAN,

"Chi sono io?" è il titolo dato ad una serie di domande e risposte relative alla Ricerca Interiore. Le domande furono poste a Bhagavan Sri Ramana Maharshi da un certo Sri M. Sivaprakasam Pillai nell'anno 1902.

Sri Pillai, uno studente di Filosofia, era all'epoca impiegato presso il Revenue Department of the South Arcot Collectorate. Durante un viaggio di lavoro a Tiruvannamalai nel 1902, egli arrivò al Virupaksha Cave, presso Arunachala Hill, e qui incontrò il Maestro.
Cercava in lui una guida spirituale, e lo pregò di rispondere alle sue domande sulla Ricerca Interiore. Poiché il Bhagavan allora non parlava, non perché avesse fatto un voto, ma semplicemente perché non aveva inclinazione a parlare, rispose a gesti alle domande postegli, e quando questi non erano capiti, rispose scrivendo.
Come risulta dalle trascrizioni di Sri Sivaprakasam Pillai, ci furono quaranta domande e relative risposte date dal Bhagavan.
Queste trascrizioni furono pubblicate per la prima volta da Sri Pillai nel 1923, insieme ad un paio di poesie, composte da lui stesso, sul modo in cui la grazia del Bhagavan aveva operato nel suo caso, chiarendo i suoi dubbi e salvandolo da una crisi esistenziale.

'Chi sono io?' è stato successivamente pubblicato in più edizioni. In alcune vi abbiamo trovato trenta domande e risposte, in altre ventotto. C'è anche un'altra versione pubblicata nella quale non sono presenti le domande e gli insegnamenti sono stati riportati in forma di saggio. L'attuale traduzione inglese è relativa proprio a questo saggio. Quella che state leggendo è invece la traduzione del testo con ventotto domande e risposte.

Insieme al Vicharasangraham (Indagine Interiore), il Nan Yar (Chi sono io?) costituisce il primo gruppo di istruzioni proveniente dalle parole del Maestro. Questi due sono gli unici scritti in prosa tra i lavori del Bhagavan. Essi mostrano chiaramente il cuore dell'insegnamento: la via diretta per la liberazione è la Ricerca Interiore. Il modo specifico in cui bisogna condurre tale Ricerca è lucidamente mostrato nel Nan Yar.
La mente è composta da pensieri. Il concetto di "Io" è il primo ad affacciarsi alla mente. Quando viene costantemente posta la domanda 'Chi sono io?', tutti gli altri pensieri si dissolvono, ed alla fine, lo stesso concetto di "Io" svanisce e ciò che rimane è il supremo Sé non duale.
La falsa identificazione del Sé con i fenomeni del non Sé, come il corpo e la mente, alla fine scompaiono e si ha l'Illuminazione, Sakshatkara.
Il processo di autoindagine naturalmente non è così facile da compiere. Mentre ci si domanda 'Chi sono io?', altri pensieri si affacciano alla mente; ma mentre essi compaiono, non bisognerebbe fare l'errore di seguirne il corso, ma, al contrario, bisognerebbe chiedersi: 'A chi compaiono ?' Per far ciò bisogna essere estremamente vigili. Tramite il continuo interrogarsi si dovrebbe portare la mente a restare in quiete, senza consentire che vaghi nel labirinto dei suoi stessi pensieri.
Tutte le altre discipline quali il controllo del respiro e la meditazione sulle Forme di Dio potrebbero essere usate quali pratiche ausiliarie. Esse sono utili in quanto aiutano la mente a rimanere calma e concentrata. Per la mente che ha conseguito una certa esperienza nella concentrazione, l'Auto Osservazione diviene conseguentemente facile.
E' con l'osservazione costante che i pensieri vengono distrutti e si realizza il Sé - la piena Realtà nella quale scompare anche il concetto di "Io"; l'esperienza chiamata il "Silenzio".

Questo, in sostanza, è l'insegnamento di Bhagavan Sri Ramana Maharshi contenuto nel Nan Yar (Chi sono Io?).

Università di Madras 30 giugno 1982

* * * Om Namo Bhagavathe Sri Ramanaya * * *

Chi sono io?
Così come tutti gli esseri viventi desiderano essere sempre felici, senza dolori, così avviene per chiunque osservi il supremo amore per il Sé, e poiché solo la felicità è la causa dell'amore, per ottenere questa felicità, che è la propria natura, e che si sperimenta nello stato di sonno profondo, dove non c'è la mente, bisogna conoscere se stessi.
Per fare questo - il cammino della Conoscenza - il mezzo principale è il chiedersi "Chi sono Io?".

* * *

1 . Chi sono Io ?
Io non sono il corpo materiale, che è composto dai sette umori (dhatus); Io non sono i cinque organi di senso, ossia il senso dell'ascolto, del gusto, dell'olfatto, del tatto e della vista, che comprendono i loro relativi oggetti, il suono, il sapore, l'odore, il tatto ed il vedere; Io non sono i cinque organi conoscitivi, ossia gli organi del parlare, del movimento, del tocco, di escrezione e di procreazione, che hanno come loro rispettive funzioni il parlare, il muoversi, il toccare, il secernere ed il godere; Io non sono i cinque soffi vitali, prana ecc., che comprendono le cinque rispettive funzioni dell'inspirare ecc.; Io non sono neanche la mente che pensa; così come non sono il ricordo, che riguarda solo le impressioni residue degli oggetti e nel quale non vi sono né oggetti né funzioni.

2 . Se io non sono nessuno di questi, chi sono?
Dopo aver negato tutte queste cose come "né questo", "né quello", rimane solo la Consapevolezza - quella io sono.

3 . Qual è la natura della Coscienza?
La natura della Coscienza è esistenza-coscienza-beatitudine.

4 . Quando raggiungeremo la realizzazione del Sé?
Quando il mondo, che è l'oggetto del percepire, sarà rimosso, ci sarà la realizzazione del Sé, che è il percipiente.

5 . Non ci sarà realizzazione del Sé finché ci sarà il mondo (percepito come reale)?
Non ci sarà.

6 . Perchè?
Il percipiente e l'oggetto percepito sono come la corda ed il serpente. Come non si riconosce la corda, che è il substrato, fin quando non scompare l'illusoria percezione del serpente, così la realizzazione del Sé, che è il substrato, non sarà raggiunta finché non si rimuoverà la convinzione della realtà del mondo.

7 . Quando sarà rimosso il mondo, che è l'oggetto percepito?
Quando la mente, che é la causa di tutte le nozioni e di tutte le azioni, sarà placata, il mondo scomparirà.

8 . Qual è la natura della mente?
Ciò che è chiamato "mente" è un meraviglioso potere che risiede nel Sé. Essa provoca l'apparire di tutti i pensieri. Eliminati i pensieri scompare anche la mente. Quindi il pensiero è la natura della mente. Eliminati i pensieri non c'è un'entità separata chiamata mondo. Nel sonno profondo non ci sono pensieri, e non c'è mondo. Nello stato di sogno ci sono pensieri e c'è anche un mondo. Proprio come un ragno emette il filo (della ragnatela) fuori di sé e poi lo ritira in sé, così la mente proietta il mondo fuori di sé e poi lo riporta in sé. Quando la mente esce dal Sé il mondo appare. Quindi, finché il mondo appare (essere reale), il Sé non appare, e quando il Sé appare (rifulge), il mondo scompare.
Quando una persona si interroga costantemente sulla natura della mente, la mente se ne va, lasciando il Sé. Ciò che viene chiamato "Sé" è l'Atman.
La mente esiste sempre solamente in quanto legata a qualcosa di materiale. Non può esistere da sola. Questa mente viene chiamata "corpo sottile", o anima (jiva).

9 . Qual è la strada da seguire per comprendere la natura della mente?
Ciò che appare quale "io" in questo corpo è la mente. Se qualcuno si chiedesse dove, nel corpo, risieda il senso dell' "io", scoprirebbe che esso risiede nel cuore. Questo è il posto nel quale ha origine la mente. Anche se uno pensa costantemente "io", "io", egli viene condotto in quel posto. Di tutti i pensieri che appaiono nella mente, quello dell'"io" è il primo. E' solo successivamente a questo pensiero che tutti gli altri si manifestano. E' dopo che è apparso il primo pronome personale che possono apparire il secondo ed il terzo; senza il primo pronome personale non ci sarebbero né il secondo né il terzo.

10 . Come si può placare la mente?
Chiedendosi: "Chi sono io?". Il chiedersi "Chi sono io" distrugge tutti gli altri pensieri, e come il bastoncino usato per accendere la pira, esso stesso alla fine scomparirà. In quel momento si avrà l'Autorealizzazione.

11 . Cosa significa concentrarsi costantemente sul pensiero "Chi sono io?"
Quando appaiono gli altri pensieri, non bisognerebbe dargli attenzione, ma chiedersi: "A chi appaiono?". La risposta che emergerà sarà: "a me". Conseguentemente se ci si chiede "Chi sono io?", la mente risale alla sua sorgente; ed il pensiero che era sorto diverrà quiescente. Con questo esercizio la mente svilupperà la capacità di rimanere in se stessa. Quando la mente, che è sottile, si proietta tramite il cervello e gli organi di senso, appaiono i nomi e le forme materiali; quando invece rimane nel cuore, nomi e forme scompaiono. Non proiettandola, ma ritenendola nel Cuore si ha ciò che viene chiamata "consapevolezza interiore" (antar-mukha). Proiettando la mente fuori dal Cuore si ha invece ciò che vien detta "consapevolezza esteriore" (bahir-mukha). In tal modo, quando la mente sta nel Cuore, l'"io", che è l'origine di tutti i pensieri, scompare, ed il Sé, eterno, si manifesta. Qualunque azione si compia, bisognerebbe farla senza il senso dell'"io". Se si agisce in questo modo tutto apparirà come la natura di Shiva (Dio).

12 . Ci sono altri metodi per spegnere la mente?
Non ci sono altri metodi adeguati oltre l'autosservazione. Benché anche con altri metodi possa sembrare di aver placato la mente, essa poi risorgerà. Anche attraverso il controllo del respiro la mente si tranquillizza, ma rimane tale solo finché il respiro rimane controllato, e, non appena termina tale controllo, anche la mente si rimette in moto, spinta dalle impressioni residue.
L'origine è la stessa sia per il respiro che per la mente. Il pensiero, in verità, è la natura della mente. Il concetto di "io" è il primo pensiero della mente, e questa è l'egoità. E' da ciò da cui nasce l'egoità che origina anche il respiro. Quindi, quando la mente diventa tranquilla, anche il respiro diventa controllato, e quando il respiro viene controllato la mente si placa. Ma nel sonno profondo, benché la mente si fermi, il respiro non cessa. Questa è la volonta di Dio, affinché il corpo sia preservato e gli altri non credano che si sia morti.
Nello stato di veglia e nel samadhi, quando la mente diventa tranquilla anche il respiro diviene regolare. Il respiro è la forma concreta della mente. Fino all'ora della morte la mente mantiene il respiro nel corpo, e quando il corpo muore la mente porta via con sé il respiro. Per questo l'esercizio del controllo del respiro è solo un aiuto per placare la mente (manonigraha); esso non la distrugge (manonasa).
Allo stesso modo le altre pratiche della meditazione sulla forma di Dio, la ripetizione dei mantra, le restrizioni sul cibo ecc. sono solo aiuti per placare la mente. Attraverso la meditazione sulle forme di Dio e la ripetizione dei mantra, la mente diviene concentrata. La mente si risveglierà sempre. Come quando un elefante viene incatenato ad un tronco e non può far altro che spostarsi per quanto lo permette la catena, così quando la mente è occupata con un nome o una forma essa si manterrà solo su quella.
Quando la mente si espande su infiniti pensieri, ogni pensiero è debole, ma quando i pensieri svaniscono la mente si concentra e si rafforza; per questo una mente auto osservante diviene docile. Di tutte le regole ascetiche, quella relativa all'assumere cibo sattvico in quantità moderate è la migliore; osservando questa regola la qualità sattvica della mente aumenta e questo aiuterà l'autosservazione.

13 . Le impressioni residue (pensieri) degli oggetti sembrano susseguirsi come le onde dell'oceano. Quando esse saranno tutte distrutte?
Quando la meditazione sul Sé diverrà sempre più profonda i pensieri si annulleranno.

14 . Nelle circostanze quotidiane, è possibile risolvere le impressioni residue degli oggetti che appartengono al continuo divenire e quindi stabilizzarsi nel Puro Sé?
Senza porsi il problema se sia possibile o meno, la persona dovrebbe perseverare nella meditazione sul Sé. Anche se uno fosse un grande peccatore, egli non dovrebbe rattristarsi e lamentarsi dicendo: "Oh! Io sono un grande peccatore, come potrò essere salvato?". Dovrebbe rinunciare completamente al pensiero "io sono un peccatore" e concentrarsi acutamente nella meditazione sul Sé. In questo modo avrà certamente successo. Non ci sono due menti, una buona e l'altra cattiva; la mente è solo una. Sono le impressioni residue che sono di due tipi - positive e negative. Quando la mente è sotto l'influenza di impressioni positive è chiamata buona; e quando è sotto l'influenza di impressioni negative è vista come cattiva.
Non si dovrebbe permettere alla mente di interessarsi agli oggetti materiali ed a ciò che riguarda gli altri. Per quanto cattiva una persona possa essere, non bisognerebbe portarle astio. Sia il desiderio che l'avversione andrebbero evitati. Tutto ciò che si dà agli altri lo si dà a se stessi. Comprenendo questa verità chi non darà agli altri? Quando uno si eleva tutti si elevano; quando si abbassa tutti si abbassano. Tanto più ci comporteremo umilmente, tanto più vedremo il bene. Quando la mente è annullata si può vivere dovunque.

15 . Per quanto tempo bisogna praticare l'autosservazione?
Fin quando gli oggetti lasciano un'impressione sulla mente è necessario chiedersi "chi sono io?". Quando sorgono i pensieri essi dovrebbero essere distrutti alla radice, tramite l'osservazione. Se si assurge alla contemplazione del Sé senza interruzioni, fino a quando il Sé sia realizzato, allora esisterà solo quello. Finché vi saranno nemici nella fortezza essi continueranno ad uscire, ma se essi saranno distrutti appena emergono, la fortezza cadrà nelle nostre mani.

16 . Qual è la natura del Sé?
L'unica cosa che esiste veramente è il Sé. Il mondo, l'anima individuale, e Dio, sono sue manifestazioni. Come l'argento nella madreperla questi tre appaiono insieme, ed insieme scompaiono. Il Sé è ciò che rimane quando non c'è assolutamente più nessun senso di "io". Questo stato è chiamato "silenzio". Il Sé stesso è il mondo, il Sé stesso è l'"io", il Sé stesso è Dio; tutto è Shiva, il Sé.

17 . Non è ogni cosa creazione di Dio?
Il sole sorge senza desiderio, volere o sforzo; e con la sua sola presenza la pietra di sole emette fuoco, il loto sboccia, l'acqua evapora, la gente svolge le sue attività e tutto il resto. Come in presenza del magnete la bussola si muove, è in virtù della mera presenza di Dio che le anime governate dalle tre (cosmiche) funzioni o dalla quintuplice attività divina, svolgono le loro funzioni e tutto il resto, in accordo con il loro proprio karma. Dio non ha proposito; nessun karma lo vincola. Questo è come le azioni del mondo che non influenzano il sole, o come i meriti e demeriti degli altri quattro elementi non influenzano tutto lo spazio infinito.

18 . Qual è il più grande tra i devoti?
Il più eccellente è colui che porta se stesso al Sé, che è Dio. Giungere a Dio significa rimanere costantemente nel Sé, senza lasciare spazio al sorgere di alcun altro pensiero che quello del Sé. Dio sopporta qualunque carico gli sia affidato. Poiché il supremo potere di Dio si prende cura di ogni cosa, perchè noi, senza lasciarli a Lui, costantemente ci preoccupiamo con i pensieri su cosa debba essere fatto e come e su cosa non debba essere fatto e perchè? Noi sappiamo che il treno porta tutti i pesi e quindi, perchè, dopo esserci saliti, dovremmo stare scomodi e portare i piccoli bagagli sulla testa anziché posarli sul treno e riposarci?

19. Cosa è il non-attaccamento?
Il non attaccamento consiste nel distruggere tutti i pensieri alla radice non appena sorgono. Proprio come il pescatore di perle lega una pietra alla cintola, si immerge nel mare e lì pesca le perle, così ciascuno di noi dovrebbe dotarsi del non attaccamento, scendere in se stesso ed ottenere la perla del Sé.

20 . Non è possibile per Dio e per il Maestro liberare un'anima?
Dio ed il Maestro mostreranno solo la strada verso la liberazione; essi non porteranno da soli l'anima alla liberazione. In verità Dio ed il Maestro non sono differenti. Proprio come la preda che è finita tra le fauci di una tigre non ha scampo, così colui che sarà accolto nella amorevole protezione del Maestro verrà da lui salvato e non si perderà, ma tuttavia dovrà percorrere in prima persona il sentiero mostrato dal Maestro o da Dio, ed ottenere la liberazione. Ciascuno può conoscere se stesso solo con la propria facoltà di conoscenza e non con quella di un altro. Colui che è Rama dovrebbe usare uno specchio per sapere che lui è Rama?

21 . E' necessario per chi vuole raggiungere la liberazione interrogarsi sulla natura delle categorie (tattvas)?
Così come colui che deve gettare della spazzatura non ha bisogno di analizzarla e vedere cosa sia, allo stesso modo chi vuole conoscere il Sé non ha bisogno di contare il numero di categorie o porsi domande al riguardo; ciò che deve fare è rigettare completamente tutte le categorie che nascondono il Sé. Il mondo andrebbe considerato come un sogno.

22 . Non c'è differenza tra veglia e sogno?
La veglia è lunga ed il sogno breve; non ci sono altre differenze.Come lo stato di veglia sembra reale quando ci si sveglia, così accade nel sogno mentre si sogna. Nel sogno la mente utilizza un altro corpo. In entrambi gli stati di sogno e veglia, pensieri, nomi e forme occorrono simultaneamente.

23 . E' utile leggere libri per coloro che aspirano alla liberazione?
Tutti i libri affermano che per ottenere la liberazione è necessario assopire la mente, quindi la sostanza di tutti gli insegnamenti è che la mente va resa quiescente; quando si è capito questo non c'è utilità nel leggere senza posa. Per acquietare la mente bisogna solamente interrogarsi su cosa sia il Sé; come potrebbe essere condotta sui libri questa ricerca? Ciascuno dovrebbe conoscere il proprio Sé con i propri occhi della saggezza. Il Sé è nelle cinque guaine, ma i libri no. Dal momento che il Sé va scoperto eliminando le cinque guaine, è futile cercarlo nei libri. Verrà il momento in cui bisognerà dimenticare tutto ciò che si è imparato.

24 . Cos'è la felicità?
La felicità è la vera natura del Sé; felicità e Sé non sono differenti. Non c'è felicità in nessun oggetto del mondo. Nella nostra ignoranza crediamo di poter trovare felicità negli oggetti. Quando la mente se ne va, sperimenta il dolore. In realtà, quando i suoi desideri sono soddisfatti, essa torna nel suo posto di origine e gioisce la felicità che è il Sé. Allo stesso modo, nello stato di sonno, samadhi ed incoscienza, e quando l'oggetto desiderato viene ottenuto, o l'oggetto odiato è rimosso, la mente rientra in se stessa e gioisce del puro Sé-Beatitudine. La mente entra ed esce dal Sé senza posa. Sotto l'albero l'ombra è riposante, oltre, il caldo è insopportabile. Una persona che è stata al sole sperimenta la frescura quando raggiunge l'ombra. Colui che continuamente, stando all'ombra, va al sole e poi torna all'ombra è un pazzo. L'uomo saggio è quello che rimane all'ombra. Allo stesso modo la mente di colui che conosce la Verità non lascia il Brahman. La mente dell'ignorante, al contrario, si immerge nel mondo, lo trova miserevole, e per un breve periodo torna al Brahman per sperimentare la felicità. Infatti ciò che viene chiamato mondo sono solo pensieri. Quando il mondo scompare, ossia quando non vi sono più pensieri, la mente sperimenta la felicità, e quando il mondo appare essa si trova nella miseria.

25 . Cos'è la visione interiore consapevole (jnana-drsti)?
E' il rimanere nella quiete. Per far ciò bisogna sciogliere la mente nel Sé. La telepatia, il conoscere il passato, il presente ed il futuro e la chiaroveggenza, non sono visione interiore consapevole.

26 . Qual è la relazione tra assenza di desiderio e saggezza?
Assenza di desiderio è conoscenza. Le due cose non sono differenti; sono la stessa cosa. Assenza di desiderio è il rifiutarsi di rigirare la mente intorno ad ogni oggetto. Saggezza è la scomparsa di ogni oggetto. In altre parole, cercare ciò che è diverso dal Sé non è assenza di desiderio e non abbandonare mai il Sé è saggezza.

27 . Che differenza c'è tra l'interrogarsi ed il meditare?
Interrogarsi consiste nel ritirare la mente nel Sé. Meditazione è pensare che il proprio Sé è Brahman, Esistenza-Coscienza-Beatitudine.

28 . Cos'è la liberazione?
Interrogarsi sulla natura del proprio io ridotto in schiavitù, e realizzare che la propria vera natura è libera.





di Ramana Maharshi

E' da un po' di tempo che mi sto dedicando all'approfondimento dei sette stadi di conoscenza (7 Bhumika) indicati da Sri Ramana nei suoi Insegnamenti Spirituali. Nel corso di questa ricerca ho trovato riscontro a quanto esposto da Sri Ramana nei Testi sacri, le Upanisad.

Malauguratamente si tratta, in genere, di Upanisad non tradotte in italiano ma, poiché l'argomento dei 7 Bhumika – e loro implicazioni- non mi pare sia ancora mai stato trattato qui sul Forum, ritengo possa risultare comunque utile. Siccome l'esposizione risulterà alla fine piuttosto lunga, ho pensato di suddividere il tutto in vari post.

Cominciamo dal testo di Sri Ramana già presente qui nel Forum:

(Upadesha Manjari)
di Ramana Maharshi



1. Qual è lo stato di conseguimento della conoscenza?

E' il dimorare fermo e senza sforzo nel Sé in cui la mente che è divenuta uno con il Sé non emerge ancora in seguito mai più. Questo è, così come ognuno si rende conto abitualmente e naturalmente che, "io non sono una capra né una mucca né alcun altro animale ma un uomo", quando pensa al suo corpo, così anche quando si rende conto che "io non sono i principi (tatwas) che cominciano con il corpo e finiscono con il suono (nada), ma il Sé che è esistenza, coscienza e beatitudine", l'innata autocoscienza (atmaprajna), egli è detto aver conseguito una ferma conoscenza.

2. A quale dei sette stadi di conoscenza (jnana-bhoomikas) appartiene il saggio?

Egli appartiene al quarto stadio.

3. Se è così perché esistono tre stadi che possono essere distinti superiori ad esso?

I segni degli stadi da quattro a sette sono basati sull'esperienza della persona realizzata (jivanmukta). Essi non sono stadi di conoscenza e di realizzazione. Fino a che conoscenza e realizzazione hanno influenza, non vi è alcuna distinzione qualsiasi cosa sia fatta in questi quattro stadi.
I sette jnana bhoomikas sono:

1. subheccha (desiderio d’illuminazione)
2. vicharana (indagine)
3. tanumanasa (mente tenue)
4. satwapatti (autorealizzazione)
5. asamsakti (non attaccamento)
6. padarthabhavana (non percezione degli oggetti)
7. turyaga (trascendenza)

Coloro che hanno conseguito i quattro ultimi bhoomikas sono detti brahmavit, brahmavidvara, brahmavidvariya e brahmavid varistha rispettivamente.

4. Dato che la liberazione è comune a tutti, perché soltanto il varistha (lett. il più eccellente) è lodato eccessivamente?

Fino a che la comune esperienza di beatitudine del varistha ha influenza egli è lodato solo a causa degli speciali meriti acquisiti nelle sue vite precedenti che sono la causa di ciò.

5. Poiché non esiste nessuno che non desideri sperimentare una costante beatitudine qual è la ragione per cui non a tutti i saggi riesce di conseguire lo stato di varistha?

Non può essere ottenuto dal puro desiderio o dallo sforzo. Il karma (prarabdha) è la sua causa. Poiché l'ego muore insieme alle sue cause già nei quattro stadi (bhoomika), quale agente rimane oltre quel livello per desiderare qualcosa o fare sforzi? Fino a che compiranno sforzi non saranno saggi (jnanis). Forse che le sacre scritture (sruti) con una menzione speciale per il varistha dicono che gli altri tre sono persone non illuminate?

6. Dato che qualche testo sacro dice che lo stato supremo è quello in cui gli organi dei sensi e la mente sono completamente distrutti, come può quello stato essere compatibile con l'esperienza del corpo e dei sensi?

Se ciò è avvenuto non dovrebbero più esserci differenze tra quello stato e lo stato di sonno profondo. Inoltre come si può dire che sia lo stato naturale quando esiste una volta e l'altra no? Ciò accade a qualche persona, come si è detto prima, in accordo con il suo karma (prarabdha) per qualche tempo o sino alla morte. Non può essere visto esattamente come lo stato finale. Se così fosse ciò significherebbe che tutte le grandi anime ed il Signore, che sono stati gli autori dei lavori Vedantici (jnana granthas) e dei Veda, sono stati persone non illuminate. Se lo stato supremo è quello in cui né i sensi né la mente esistono e neppure lo stato in cui essi esistono come potrebbe essere lo stato perfetto (paripurnam)? Poiché soltanto il karma è responsabile dell'attività o dell'inattività dei saggi, le grandi anime hanno decretato essere lo stato ultimo soltanto quello di sahaja nirvikalpa (lo stato naturale senza concetti).

7. Qual è la differenza tra sonno ordinario e sonno cosciente (jagrat sushupti)?

Nel sonno ordinario non solo non vi sono pensieri, ma neppure consapevolezza. Nel sonno cosciente c'è soltanto consapevolezza. Questo è il motivo per cui è chiamato cosciente sebbene dormiente, questo è il sonno in cui c'è consapevolezza.

8. Perchè il Sé è descritto in entrambi i modi, come quarto stato e come oltre il quarto stato (turiyatita)?

Turiya significa che quello è il quarto. Gli sperimentatori (jivas) dei tre stati di veglia, sogno e sonno profondo, conosciuti come visva, taijasa e prajna, che vagano in successione in questi tre stati, non sono il Sé. E’ con l'obbiettivo di rendere ciò chiaro, vale ad dire che il Sé è ciò che è diverso da essi e che è testimone di quegli stati, che esso è chiamato il quarto (turiya). Quando questo viene compreso i tre sperimentatori scompaiono e l'idea che il Sé è il testimone, che è il quarto, pure scompare. Questo è il motivo per cui il Sé viene descritto come oltre il quarto (turiyatita).

9. Qual è il beneficio derivato al saggio dalle sacre scritture (srutis)?

Per il saggio che è l'incarnazione delle verità menzionate nelle scritture esse non hanno utilizzo.

10. Vi è qualche connessione tra il conseguimento dei poteri supernaturali (siddhis) e la Liberazione (mukti)?

Soltanto l'indagine illuminata conduce alla Liberazione. I poteri supernaturali sono tutti apparenze illusorie create dal potere di maya (mayashakti). L'autorealizzazione che è permanente è il solo vero talento (siddhi). I talenti che appaiono e scompaiono, essendo effetti di maya, non possono essere reali. Essi sono compiuti con l'obbiettivo di raggiungere fama, piaceri, ecc. Essi compaiono spontanei in qualche persona grazie al loro karma. Sappi che l'unione con il Brahman è lo scopo reale di tutti i talenti. Questo è anche lo stato di Liberazione (aikya mukti) conosciuto come unione (sayujya).


1. continua...


Una delle Upanisad in cui si trovano esposti i sette stadi di conoscenza (7 Bhumika) è la Mahopanisad, facente parte del Sama-Veda:



Translated by Dr. A. G. Krishna Warrier


Chapter V.



By knowing the seven stages of knowledge, one will not be sub-merged in the mire of illusions.
Many schools speak variously of the stages of Yoga but only the following are acceptable to me:
liberation follows after the seven stages.

The first stage of knowledge – is auspicious desire, the second is reflection, the third is thinning of the mind, the fourth is attainment of Sattva, then detachment, the sixth is reflection on objects and the seventh is of the Turiya.

Their explanation:

The wise say that the auspicious desire is the desire following detachment –meditation ‘why do I remain like a fool, being looked upon by good people ?’

Reflection is good activity (tendency) after the practice of detachment and contact with scriptures and good people.

Thinning of the Mind is the condition where the attachment to sense-objects is reduced by means of auspicious desire and reflection.

Sattvapatti is the mind in the pure Sattva condition by the practice of the above three stages.

The Asamsakti stage is the developed condition, without even a trace of involvement, by means of the practice of the four stages.

Padarthabhavana is the sixth stage resulting from the five stages, delighting in the spirit firmly by the non-contemplation of objects internal and external.

The ‘Fourth’ (Transcendental) condition (here the seventh) is concentration on one’s nature, seeing no real difference, by the long practice of the six stages – this is the stage of Jivanmukti.

The stage ‘Beyond the Fourth’ is the stage of liberation without the body.


Nidagha, those who have reached the seventh stage, delight in the spirit – they do not drown in pleasure and pain.

They do (or not do) whatever is only relevant and minimal.

They perform actions following the past, awakened (impelled) by those nearby, like one waking from sleep.

These seven stages can be known only by the enlightened – reaching which condition, even animals, barbarians etc., are liberated with or without the body surely.

Wisdom indeed is the breaking of the knot and the liberation – the dying of the illusion of mirage.

But those who have crossed the ocean of illusion – they have reached the high position.

The means of calming the mind is said to be Yoga.
This is to be known as having seven stages which lead to the status of Brahman.

There, there is no feeling of ‘you’ and ‘I’, one’s own and another, nor the perception of existence or non-existence.

All is calm (needing) no support, existing in the ether (of the heart), eternal, auspicious, devoid of ailment and illusion, name and cause.

Neither existent nor-existent, nor in between, nor the negation of all; beyond the grasp of mind and words, fuller than the fullest, more joyful than joy.

Beyond (worldly) perception, the limit of one’s hope (horizon) extensive, there is no existence of any thing other than pure cognition.


* * * * *

Ancora, se ne trova una breve esposizione nell'Annapurna Upanisad, facente parte dell'Atharva-Veda:


Translated by Dr. A. G. Krishna Warrier


Chapter V.


V-81. The first plane, generating the desire for liberation, is marked by the practice (of discipline) and detachment due to intimacy with the Shastras and the company of the holy.

V-82. The second is marked by investigation;
the third by contemplation with (all) its accessories;
the fourth is the solvent as it consists in the dissolution of latent impressions.

V-83. The fifth is the rapturous; it is purely cognitive.
This is the station of the Liberated-in-life who is, as it were, half awake and half asleep.

V-84. The sixth plane is non-cognitive.
It is the station similar to deep sleep, having the nature of pure and massive bliss.

V-85. The seventh plane is (marked by) equability, utter purity, tenderness;
it is indeed unqualified liberation, the quiescent Fourth State.

V-86. The transcendent state beyond the Fourth, Nirvana in its essence, is the transcendent and developed seventh plane;
it does not come within the purview of mortals.

V-87. The first three constitute but the wakeful life;
the fourth is called the dream (state) where the world is regrettably dream-like.

V-88. The fifth, conforming to massive bliss, is styled deep sleep.
In contrast the sixth which is non-cognitive is named the Fourth State.

V-89. The most excellent seventh plane is the state beyond the Fourth,
beyond the range of mind and words,
and identified with the self-luminous Being.


2 - continua...


Un'altra Upanisad in cui si parla dei sette stadi della conoscenza è la Akshi Upanisad, facente parte del Krishna-Yajur-Veda, ma in essa c'è qualcosa in più rispetto alle altre suesposte, perché in essa si fa accenno al collegamento con gli stati rappresentati dall'AUM:


Translated by Dr. A. G. Krishna Warrier




3. (The adepts) know Yoga to be the non-knowing (of plurality), the spontaneous attrition of the (object-seeking) mind.
Rooted in Yoga, perform actions, or, averse (to all actions), perform (them) not at all.

4. Aversion is felt everyday to inborn tendencies (to act); nevertheless, one tends to plunge into noble actions with gusto.

5-6. Always one hesitates as regards the instinctive actions of the unregenerate; one never refers to what may compromise others, but attends to their righteous deeds.
One does gentle deeds that pain none; always dreads sin and avoids all forms of sense-gratification.

7. Such a one’s speech is informed by affection and love; it is lovely and fit, with due regard to time and place.

8. With proper thought, act and speech, one waits upon the virtuous. Getting them from all conceivable sources, one studies the Shastras.

9-10(a). Then one attains the first stage of Yoga.
Whoever entertains such thoughts as regards the crossing of transmigratory life is said to have attained a state of Yoga. The rest are said to be just ‘noble’ (arya).

10(b)-11. Coming to the next stage of Yoga, called ‘Analysis’ (vichara), the sadhaka resorts to the foremost scholars, well-known for their serious interpretations of Sruti and Smriti, good conduct, fixed attention, contemplation and activities.

12. As a house-holder (knows) his homestead, (so), having mastered all that has to be learned, the sadhaka comes to know the categories, and the doctrines, vis-à-vis what has to be done and avoided.

13. As a snake sheds its Slough, so sheds he even a slight attachment to external objects when intensified by pride, conceit, intolerance, greed and delusion.

14. With a mind disciplined through devotion to the Shastras, teacher, and the company of the virtuous, he truthfully masters the entire body of knowledge including the secret doctrines.

15. Just as a lover repairs to a spotless bed of flowers, from the second, he (the sadhaka) proceeds to the third state styled Non-attachment.

16-17. Fixing his steady mind on the truthful import of the Shastras and busy with the recitation of spiritual texts proper to the hermitages of the ascetics, he expends his long life, seated on a bed of stone or a slab, diverting himself with ramblings in the forest, made beautiful by his placid mind.

18. As a result of his meritorious actions, the righteous (sadhaka) passes his time in the delights of detachment, repeatedly studying the positive Shastras.

19. One’s perception of reality becomes clear only in due course.
The enlightened one, reaching the third stage, experiences this for himself.

20. Non-attachment is of two kinds: listen to the distinction as it is being drawn. This non-attachment is of two-kinds; one general and the other, superior.

21. The general non-attachment is non-involvement in objects, (based on the perception) ‘I am neither agent nor enjoyer, neither the sublater nor the sublated’.

22. ‘Everything, be it pleasure or pain, is fashioned by prior deeds; or, everything is under the sway of the Lord. I do nothing in regard to it’.

23. ‘Enjoyments and non-enjoyments are dread diseases; possessions are great disasters.
All contacts just promote separation. Sufferings are diseases of thoughts’.

24. ‘Time is ceaselessly fashioning all things’ – so the general non-attachment of (the sadhaka) who has grasped the import of (the major texts) consists in being averse to all things and in not dwelling on them mentally.

25-26. By cultivating this sequence (of stages), the superior non-attachment in the case of the magnanimous (sadhakas) supervenes.
It is said to be silence, repose and quiescence.
For speech and import have been flung far away in the light of the truth, ‘I am no agent; the agent is God or my own prior actions’.

27. The first stage that occurs is sweet on account of the satisfaction and joy (that attend it).
The sadhaka (puman) has just stepped into the sequence of states.
The first is an ambrosial sprout.

28. The first stage is the internal, cleansed, birth-place of the other stages.
Thence one attains the second and third stages.

29. Among these, the all-pervading third (stage) is superior.
Here the sadhaka has outgrown all proneness to imagine (and get ensnared).

30. Those who reach the fourth (stage) after the dwindling of nescience through the exercises of the three stages look on all things with the same eye.

31. When non-duality is established and duality dissolved, those who have reached the fourth stage look upon the phenomenal world as a dream.

32. The first three states are said to be the waking state; the fourth is called the dream state.
And the mind dissolves like the fragments of an autumnal cloud.

33. He who reaches the fifth stage survives but as bare being.
Due to the dissolution of the mind in this stage the world-manifold does not present itself at all.

34. Reaching the fifth stage called ‘deep sleep’, the sadhaka remains as pure non-dual being, all particulars having completely vanished.

35. Having reached the fifth stage, one stays consolidated in deep sleep, joyful, inwardly awake, all dual appearances gone.

36. Looking inwards, even when attending to outer things, he appears always indrawn, being extremely exhausted.

37. Practising in this fifth stage, free from all innate impulses, one reaches, as a matter of course, the sixth stage named ‘the Fourth’.

38. Where there is neither the non-existent nor the existent, neither the ‘I’ nor the non-‘I’, with all analytic thinking gone, one stays alone, totally fearless, in non-duality.

39. Beyond knots, with all doubt vanquished, liberated in life, devoid of imaginations, though unextinguished yet extinguished, he is like a painted flame.

40. Having dwelt in the sixth stage, he shall reach the seventh.
The state of disembodied liberation is called the seventh stage of Yoga.

41-42(a). This is the acme of all stages, beyond words, quiescent.
Avoiding conformity with the ways of the world, and the ways of the body, avoiding conformity with Shastras, get rid of all superimpositions on the Self.

42(b). All that is (here), the vishva, the prajna, etc., is nothing but Om.

43. Because there is non-difference between import and expression, and because, as distinct from each other, neither of these two is known, the Vishva is just the letter ‘a’ and ‘u’ is said to be the Taijasa.

44. The Prajna is the letter ‘m’.
Thus know in order, discriminating with great effort, before Concentration (Samadhi) sets in.

45-46. In this due order the concrete and the subtle should all be dissolved in the spiritual Self and the spiritual Self (should be dissolved) perceiving ‘I am the Om Vasudeva, ever pure, awake, free, existent, non-dual massed and supreme bliss’; because all this (objective world) is pain in the beginning, middle and end.

47-48. Therefore, thou sinless one, renouncing everything, be devoted to Truth.
Think: I am Brahman, solid Intelligence and Bliss, free from impurity, holy, lifted above mind and words, beyond the darkness of ignorance, beyond all appearances.
This is the secret doctrine.

3. continua...


L'Upanisad nella quale questo collegamento tra gli stadi di conoscenza (7 Bhumika) e gli stati rappresentati dall'AUM sono veramente esposti in tutta chiarezza è la Varaha Upanisad, appartenente al Krishna-Yajur-Veda. Ve ne propongo il testo, suddiviso secondo i sutra in inglese, prima in sanscrito, poi nella traduzione inglese:



Translated in English by K. Narayanasvami Aiyar



atha ha rbhum bhagavantam nidaghah papraccha jivanmuktilaksanamanubruhiti |
tatheti sa hovaca |

On another occasion Nidagha asked Lord Ribhu to enlighten him as to the characteristics of Jivanmukti.
To which Ribhu replied in the affirmative and said the following:

saptabhumisu jivanmuktascatvarah |
subheccha prathama bhumika bhavati |
vicarana dvitiya |
tanumanasi trtiya |
sattvapattisturiya |
asamsaktih pancami |
padarthabhavana sasthi |
turiyaga saptami |

“In the seven Bhumikas (or stages of development of wisdom) there are four kinds of Jivanmuktas.
Of these the first stage is Subhechcha (good desire); the second is Vicharana (inquiry); the third is Tanumanasi (or pertaining to the thinned mind); the fourth is Sattvapatti (the attainment of Sattva); the fifth is Asamsakti (non-attachment); the sixth is the Padartha-Bhavana (analysis of objects) and the seventh is the Turya (fourth or final stage).

pranavatmika bhumika akarokaramakarardhamatratmika |
sthulasuksmabijasaksibhedenakaradayascaturvidhah |
tadavastha jagratsvapnasusuptituriyah |

The Bhumika which is of the form of Pranava (Om) is formed of (or is divided into) Akara – ‘A’, Ukara – ‘U’, Makara - ‘M’ and Ardha-Matra.
Akara and others are of four kinds on account of the difference of Sthula (gross), Sukshma (subtle), Bija (seed or causal) and Sakshi (witness).
Their Avasthas are four: waking, dreaming, dreamless sleeping and Turya (fourth).

akarasthulamse jagradvisvah |
suksmamse tattaijasah |
bijamse tatprajnah |
saksyamse tatturiyah |

He who is in (or the entity that identifies itself with) the waking state in the gross Amsa (essence or part) of Akara is named Vishva; in the subtle essence, he is termed Taijasa; in the Bija essence, he is termed Prajna; and in the Sakshi essence, he is termed Turya.

ukarasthulamse susuptavisvah |
suksmamse tattaijasah |
bijamse tatprajnah |
saksyamse tatturiyah |

He who is in the dreaming state (or the entity which identifies itself with the dreaming state) in the gross essence of Ukara is Vishva; in the subtle essence, he is termed Taijasa; in the Bija essence, is termed Prajna; and in the Sakshi essence, he is termed Turya.

makarasthulamse susuptavisvah |
suksmamse tattaijasah |
bijamse tatprajnah |
saksyamse tatturiyah |

He who is in the Sushupti state in the gross essence of Makara is termed Vishva; in the subtle essence, Taijasa; in the Bija essence, he is termed Prajna; and in the Sakshi essence, he is termed Turya.

ardhamatrasthulamse turiyavisvah |
suksmamse tattaijasah |
bijamse tatprajnah |
saksyamse turiyaturiyah |

He who is in Turya State in the gross essence of Ardha-Matra is termed Turya-Vishva.
In the subtle, he is termed Taijasa; in the Bija essence, he is termed Prajna; and in the Sakshi essence, he is termed Turya-Turya.

akaraturiyamsah prathamadvitiyatrtiyabhumikah |
ukaraturiyamsa caturthi bhumika |
makaraturiyamsa pancami |
ardhamatraturiyamsa sasthi |
tadatita saptami |

The Turya essence of Akara is (or embraces) the first, second and third (Bhumikas or stages of the seven).
The Turya essence of Ukara embraces the fourth Bhumika.
The Turya essence of Makara embraces the fifth Bhumika.
The Turya essence of Ardha-Matra is the sixth stage.
Beyond this, is the seventh stage.

bhumitrayesu viharanmumuksurbhavati |
turiyabhumyam viharanbrahmavidbhavati |
pancamabhumyam viharanbrahmavidvaro bhavati |
sasthabhumyam viharanbrahmavidvariyanbhavati |
saptamabhumyam viharanbrahmavidvaristho bhavati |

One who functions in the (first) three Bhumikas is called Mumukshu; one who functions in the fourth Bhumika is called a Brahmavit; one who functions in the fifth Bhumika is called a Brahmavidvara; one who functions in the sixth Bhumika is called a Brahmavidvariya; and one in the seventh Bhumika is called a Brahmavidvarishtha.

tatraite sloka bhavanti |

With reference to this, there are Slokas. They are:

jnanabhumih subheccha syatprathama samudirita |
vicarana dvitiya tu trtiya tanumanasa || 1||

1. Subhechcha is said to be the first Jnana-Bhumi (or stage of wisdom); Vicharana, the second; Tanumanasi, the third;

sattvapattiscaturthi syattato'samsaktinamika |
padarthabhavana sasthi saptami turyaga smrta || 2||

2. Sattvapatti, the fourth; then come Asamsakti as the fifth, Padartha-Bhavana as the sixth and Turya as the seventh.

sthitah kim mudha evasmi preksyo'ham sastrasajjanaih |
vairagyapurnamiccheti subhecchetyucyate budhaih || 3||

3. The desire that arise in one through sheer Vairagya (after resolving) ‘Shall I be ignorant? I will be seen by the Shastras and the wise’ (or ‘I will study the books and be with the wise’) – is termed by the wise as Subhechcha [first stage].

sastrasajjanasamparkavairagyabhyasapurvakam |
sadacarapravrttirya procyate sa vicarana || 4||

4. The association with the wise and Shastras and the following of the right path preceding the practice of indifference is termed Vicharana [second stage].

vicaranasubhecchabhyamindriyarthesu raktata |
yatra sa tanutameti procyate tanumanasi || 5||

5. That stage wherein the hankering after sensual objects is thinned through the first and second stages is said to be Tanumanasi [third stage].

bhumikatritayabhyasacitte'rthaviratervasat |
satvatmani sthite suddhe sattvapattirudahrta || 6||

6. That stage wherein having become indifferent to all sensual objects through the exercise in the (above) three stages, the purified Chitta rests on Atman which is of the nature of Sat is called Sattvapatti [fourth stage].

dasacatustayabhyasadasamsargaphala tu ya |
rudhasattvacamatkara prokta samsaktinamika || 7||

7. The light (or manifestation) of Sattva-Guna that is firmly rooted (in one) without any desire for the fruits of actions through the practice in the above four stages is termed Asamsakti [fifth stage].

bhumikapancakabhyasatsvatmaramataya bhrsam |
abhyantaranam bahyanam padarthanamabhavanat || 8||

paraprayuktena ciram pratyayenavabodhanam |
padarthabhavananama sasthi bhavati bhumika || 9||

8-9. That stage wherein through the practice in the (above) five stages one, having found delight in Atman, has no conception of the internals or externals (though before him) and engages in actions only when impelled to do so by others is termed Padartha-Bhavana, the sixth stage.

sadbhumikacirabhyasadbhedasyanupalambhanat |
yatsvabhavaikanisthatvam sa jneya turyaga gatih || 10||

10. The stage wherein after exceedingly long practice in the (above) six stages one is (immovably) fixed in the contemplation of Atman alone without the difference (of the universe) is the seventh stage called Turya.

subhecchaditrayam bhumibhedabhedayutam smrtam |
yathavadveda buddhyedam jagajjagrati drsyate || 11||

11. The three stages beginning with Subhechcha are said to be attained with (or amidst) differences and non-differences. (Because) the universe one sees in the waking state he thinks to be really existent.

advaite sthairyamayate dvaite ca prasamam gate |
pasyanti svapnavallokam turyabhumi suyogatah || 12||

12. When the mind is firmly fixed on the non-dual One and the conception of duality is put down, then he sees this universe as a dream through his union with the fourth stage.

vicchinnasaradabhramsavilayam praviliyate |
satvavasesa evaste hi nidagha drdhikuru || 13||

13. As the autumnal cloud being dispersed vanishes, so this universe perishes. O Nidagha, be convinced that such a person has only Sattva remaining.

pancabhumim samaruhya susuptipadanamikam |
santasesavisesamsastisthatyadvaitamatrake || 14||

14. Then having ascended the fifth stage called Sushuptipada (dreamless sleeping seat), he remains simply in the non-dual state, being freed from all the various differences.

antarmukhataya nityam bahirvrttiparo'pi san |
parisrantataya nityam nidraluriva laksyate || 15||

kurvannabhyasametasyam bhumyam samyagvivasanah |
saptami gadhasuptakhya kramaprapta puratani || 16||

15-16(a). Having always introvision though ever participating in external actions, those that are engaged in the practice of this (sixth stage) are seen like one sleeping when fatigued (viz., being freed from all affinities).

16(b). (Lastly) the seventh stage which is the ancient and which is called Gudhasupti is generally attained.

yatra nasanna sadrupo naham napyanahankrtih |
kevalam ksinamanana aste'dvaite'tinirbhayah || 17||

17. Then one remains in that secondless state without fear and with his consciousness almost annihilated where there is neither Sat nor Asat, neither self nor not-self.

antahsunyo bahihsunyah sunyakumbha ivambare |
antahpurno bahihpurnah purnakumbha ivarnave || 18||

18. Like an empty pot in the Akasa, there is void both within and without; like a filled vessel in the midst of an ocean, he is full both within and without.

ma bhava grahyabhavatma grahakatma ca ma bhava |
bhavanamakhilam tyaktva yacchistam tanmayo bhava || 19||

19. Do not become either the knower or the known. May you become the Reality which remains after all thoughts are given up.

drstrdarsanadrsyani tyaktva vasanaya saha |
darsanaprathamabhasamatmanam kevalam bhaja || 20||

20. Having discarded (all the distinctions of) the seer, the sight and the seen with their affinities, meditate solely upon Atman which shines as the supreme Light.


4. continua...


Considerata l'importanza di questa Upanisad, ne propongo un'approssimativa traduzione letterale in italiano:


Capitolo IV


In un’altra occasione Nidagha chiese a Lord Ribhu di illuminarlo sulle caratteristiche della Jivanmukti. Al che Ribhu rispose in modo affermativo e disse ciò che segue:

“Nei sette Bhumika (o fasi dello sviluppo della conoscenza) ci sono quattro tipi di Jivanmukta.

Di queste la prima fase è Subhechcha (buona volontà);
la seconda è Vicharana (indagine);
la terza è Tanumanasi (o relativo all’assottigliamento della mente);
la quarta è Sattvapatti (il conseguimento di Sattva);
la quinta è Asamsakti (non-attaccamento);
la sesta è Padartha-Bhavana (analisi degli oggetti);
e la settima è Turiya (Quarto, o fase finale).

Il Bhumika che è della stessa forma del Pranava (OM) è formato da (o è diviso in) Akara - ‘A’, Ukara – ‘U’, Makara - ‘M’ e Ardha-Matra.

Akara e gli altri sono di quattro tipi a causa delle differenze tra Sthula (materia), Sukshma (sottile), Bija (seme o causale) e Sakshi (testimone).

I loro stati sono quattro: veglia, sogno, sonno profondo e Turiya (Quarto).

Colui che è ne (o l’entità che s’identifica con) lo stato di veglia nell’Amsa (essenza o parte) dello stato materiale di Akara è chiamato Vishva; nell’essenza sottile è detto Taijasa; nell’essenza causale è detto Prajna; e nella parte del Testimone è denominato Turiya.

Colui che è nello stato di sogno (o l’entità che s’identifica con lo stato di sogno) nella parte materiale di Ukara è Vishva; nell’essenza sottile è detto Taijasa; nell’essenza causale è detto Prajna; e nella parte del Testimone è denominato Turiya.

Colui che è nello stato di sonno profondo nella parte materiale di Makara è denominato Vishva; nell’essenza sottile, Taijasa; nell’essenza causale è detto Prajna; e nella parte del Testimone è denominato Turiya.

Colui che si trova nello stato di Turiya nella parte materiale di Ardha-Matra è definito Turiya-Vishva. Nel sottile, è detto Taijasa; nell’essenza causale è detto Prajna; e nella parte del Testimone è denominato Turiya-Turiya.

L'essenza Turiya di Akara è (o abbraccia) il primo, il secondo e il terzo (Bhumika o fase dei sette).
L'essenza Turiya di Ukara abbraccia il quarto Bhumika.
L'essenza Turiya di Makara abbraccia il quinto Bhumika.
L'essenza Turiya di Ardha-Matra è il sesto stadio.

Oltre questo, c’è il settimo stadio.

Uno che opera nei (primi) tre Bhumika è chiamato Mumukshu; uno che opera nel quarto Bhumika è chiamato Brahmavit; uno che opera nel quinto Bhumika è detto Brahmavidvara; uno che opera nel sesto Bhumika è chiamato Brahmavidvariya; e uno nel settimo Bhumika è denominato Brahmavidvarishtha.

In riferimento a tutto questo, ci sono dei sutra. Essi sono:

1. Subhechcha è detto essere il primo Jnana-Bhumi (o fase della conoscenza); Vicharana il secondo; Tanumanasi il terzo;

2. Sattvapatti il quarto; poi come quinto viene Asamsakti, come sesto Padartha-Bhavana e come settimo Turiya.

3. Il desiderio che nasce in chi, attraverso il puro Vairagya (dopo aver risolto) ‘Devo essere ignorante? Frequenterò gli Shastra e il saggio’ (o ‘Studierò i libri e frequenterò il saggio’) – è denominato dal saggio come Subhechcha [prima tappa].

4. L’associazione con il saggio e lo studio degli Shastra e il seguire il giusto percorso che precede la pratica di vairagya è detto Vicharana [seconda fase].

5. Quella fase in cui il desiderio per gli oggetti dei sensi si è assottigliato attraverso la prima e la seconda tappa, è denominate Tanumanasi [terza fase].

6. Quella fase in cui, dopo essere diventati indifferenti agli oggetti dei sensi attraverso l’esercizio dei (summenzionati) tre stadi, la Chitta purificata si riposa nell’Atman, che è della natura di Sat, è chiamata Sattvapatti [quarta fase].

7. La luce (o la manifestazione) del guna Sattva, che è stabilmente radicata in chi, attraverso la pratica nelle suddette quattro tappe sia senza alcun desiderio per i frutti delle azioni, è denominata Asamsakti [quinta fase].

8-9. Quella fase in cui attraverso la pratica nelle (suesposte) tappe uno, avendo trovato diletto nell’Atman, non è influenzato degli oggetti interni o esterni (sebbene posti di fronte a lui) e si impegna in azioni solo quando è spinto dagli altri a farlo, è denominata Padartha-Bhavana, la sesta fase.

10. La fase in cui, dopo una pratica estremamente lunga nei (sumenzionati) sei stadi, uno è inamovibilmente stabilizzato nella contemplazione dell’Atman soltanto, senza differenziazione (dell’universo), è la settima fase detta Turiya.

11. Le tre fasi che iniziano con Subhechcha devono essere realizzate con (o in mezzo a) le distinzioni e le non-distinzioni. (Poiché) l’universo che uno vede nello stato di veglia egli lo ritiene realmente esistente.

12. Quando la mente è saldamente fissata sull’Uno non-duale e la concezione della dualità è abbandonata, allora egli vede questo universo come un sogno attraverso la sua unione con la quarta fase.

13. Come le nubi autunnali vengono disperse dal vento e svaniscono, così quest’universo scompare. O Nidagha, convinciti che in tale persona rimane solo Sattva.

14. Ormai, essendo asceso alla quinta fase chiamata Sushuptipada (stadio del sonno senza sogni), egli rimane semplicemente nello stato non-duale, libero da ogni differenziazione.

15-16 (a). Mantenendo sempre l’introversione e tuttavia mai prendendo parte ad azioni esterne, quelli che sono impegnati nella pratica di questo (sesto stadio) sono considerati come chi dorme quando è affaticato (ossia, essendo liberi da ogni legame).

16 (b). (Infine), la settima fase, che è quella primeva e che è chiamata Gudhasupti, viene generalmente ottenuta.

17. Allora uno rimane privo di timore in quello stato senza-Secondo e con la propria consapevolezza quasi annullata dove non esiste né Sat né Asat, né Sé né non-Sé.

18. Come in un vaso vuoto nell’Etere non c’è nulla né dentro né fuori; come un’imbarcazione stracarica nel mezzo dell’oceano, egli è pieno sia dentro che fuori.

19. Non diventare né il conoscitore né il conosciuto. Che tu possa divenire la Realtà che rimane dopo che tutti i pensieri sono cessati.

20. Dopo aver eliminato (tutte le distinzioni di) veggente, azione del vedere e oggetto visto con le loro affinità, medita unicamente sull’Atman, che risplende come Luce suprema.


5. continua...


Quanto viene detto nella Varaha Upanisad riguardo all'AUM, consente di apprezzare in tutta la sua estensione ciò che molto sinteticamente veniva esposto nella ben più nota Mandukya Upanisad (siccome in questo momento non riesco più a trovare la traduzione in italiano di Raphael, ne trascrivo una trovata on line con la traduzione dal sanscrito fatta da Sri Aurobindo):



dal sito web


omitietadaksharamidam sarvam tasyopavyâkhyânam
bhûtam bhavad bhavishyaditi sarvamomkâra eva;
yaccânyat trikâlâtîtam tadapyomkâra eva.

«OM è la Parola imperitura; OM è l’universo; e questa ne è l’esposizione. Il passato, il presente e il futuro, ciò che è esistito, che è e che sarà, è OM. Tutto ciò che esiste oltre i limiti del tempo, è pur esso designato da OM».

Verso 2

sarvam hyetad brahma ayam âtmâ brahma so’yam âtmâ catushpât.

«Tutto questo universo è il Brahman; questo âtman è il Brahman, e l’âtman è quadruplice».

Verso 3

jâgaritasthâno bahishprajñah saptânga ekornâmvashatimukhah sthûlabhug vaishvânarah prathamah pâdah.

«Colui che ha come sede lo stato di veglia, che possiede la conoscenza degli oggetti esteriori, dotato di sette membra e diciannove porte, che fruisce del mondo materiale, Vaishvânara, è il primo».

Verso 4

svapnasthâno’ntahprajñah saptânga ekornâmvashatimukham praviviktabhuk taijaso dvitîyah pâdah.

«Colui che ha come sede lo stato di sogno, che ha la conoscenza degli oggetti interiori, dotato di sette membra e diciannove porte, che fruisce degli oggetti sottili, Taijasa, è il secondo».

Verso 5

yatra supto na kancana kâmam kâmayate
na kancana svapnam pashyati tat sushuptam
sushuptasthâna ekî-bhûtah prajñânaghana evânandamayo hyânndabhuk cetomukhah prâjñâstritîyah pâdah.

«Quando l’essere dormiente non prova più desiderî, né è soggetto a sogni, allora si ha la condizione di sonno profondo. Colui che dimora nel sonno profondo, e che in questo è diventato uno, che è conoscenza raccolta in se stessa, che è costituito da pura beatitudine, che ha la beatitudine come campo di esperienza, la cui mente cosciente è la porta, Prâjña, è il terzo».

Verso 6

esha sarveshvara esha sarvajña esho’ntaryâmyesha yonih sarvasya prabhavâpyayau hi bhûtânâm.

«Esso è il Signore di tutto, l’Onnisciente, l’ordinatore interno, matrice dell’universo, l’origine e la fine di tutte le creature».

Verso 7

nântahprajña na bahishprajña nobhayatahprajñam na prajñânaghanam na prajñam nâprajñam;
adrishtam asyavahâryamagrâhyama lakshanamacintyamavyapadeshyamekâtmapratyayasâram prapancopashamam shântam shivam advaitam
caturtham manyante sa âtmâ sa vijñeyah.

«Il Quarto non è estroverso né introverso, né contemporaneamente dentro e fuori, non è conoscenza raccolta in se stessa, non possiede la conoscenza né la non-conoscenza, è invisibile e incomprensibile, indefinibile, impensabile, indescrivibile, l’unica essenza della conoscenza dell’âtman, senza alcuna traccia fenomenica; è pienezza di pace e di beatitudine senza dualità: questo è in verità l’Âtman, questo è l’oggetto della conoscenza».

Verso 8

so’yamâtmâdhyaksharamonkâ ro’dhimâtram pâdâ mâtrâ mâtrâshca pâdâ akâra ukâro makâra iti.

«Egli è l’Atman, è il Verbo imperituro, è OM; e ogni lettera è una sua parte: A, U, M».

Verso 9

jâgaritasthano vaishvânaro’kâroh prathamâ mâtrâ âpterâdimattvâd vâ âpnoti ha vai sarvân kâmânâ dishca bhavati ya evam veda.

«Vaishvânara, la cui sede è lo stato di veglia, è designato dalla prima lettera, la A, a causa della sua connessione con ciò che ha inizio e si espande. Colui il quale così conosce, consegue tutti gli oggetti di desiderio: ne diventa la sorgente e l’origine».

Verso 10

svapnasthânastaijasa ukâro dvitoyâ mâtrâ uktarshâbhayanvâd vâ uktarshati vai jñânasarntati ha vai jñâmânashca samânashca bhavati nâsyâbrahmavit kule bhavati ya evam veda.

«Taijasa, la cui sede è lo stato di sogno, è designato dalla seconda lettera, la U, in correlazione con avanzamento e centralità; chi in tal modo conosce, raggiunge il flusso ininterrotto di conoscenza e si eleva oltre l’indifferenza: nessuno dei suoi semi sarà privo della conoscenza del Brahman».

Verso 11

sushuptasthânah prâjño makârastritîyâ mâtrâ miterapotervâ minoti ha vâ idam sarvamapîtishca ya evam deva.

«Prâjña, la cui sede è lo stato di sonno profondo, è designato dalla terza lettera, la M, a causa della connessione con misura e finalità; colui che conosce l’universo in se stesso come misura diventa, in realtà, onnipenetrante».

Verso 12

amâtrashcaturthe’vyavahâryah prapanciopashamah
shive’dvaita evamonkâra âtmaiva samvishatyâtmanâtmânam
ya evam veda ya evam veda.

«Il Quarto stato è incommensurabile, non agente, al di là della manifestazione; è il Sommo Bene, l’Uno senza secondo: è OM. Colui il quale così conosce, diventa l’Âtman, e mediante il proprio âtman penetra nell’Âtman — colui il quale così conosce».

6. continua...


Nella Paramahamsa-Parivrajaka Upanishad, facente parte dell'Atharva-Veda, possiamo trovare conferma alla suddivisione in sedici stati di coscienza, già esposti nella Varaha Upanisad:


Translated by Prof. A. A. Ramanathan



4. The god Brahma asked (Narayana):
Lord, what is Brahma-Pranava ?

(The Lord) Narayana replied:
The Brahma-Pranava consists of sixteen parts and it is cognized in quadruples in the four states (waking, etc.,).

In the waking state there are the four states, waking within waking, etc., (jagrat-jagrat);
in the dreaming state the four states are waking within dreaming, etc., (svapna-jagrat);
in deep sleep there are the four states waking within deep sleep, etc., (susupti-jagrat);
in the fourth state (turiya) there are the four states waking within the Turiya, etc., (turiya-jagrat).

In the waking state of distributive pervasion (vyashti) there is quadruplicity of vishva, namely, vishva-vishva, vishva-taijasa, vishva-prajna and vishva-turiya.

In the dreaming state of distributive pervasion there is quadruplicity of taijasa, namely taijasa-vishva, taijasa-taijasa, taijasa-prajna and taijasa-turiya.

In the state of deep sleep of Prajna there is quadruplicity, namely prajna-vishva, prajna-taijasa, prajna-prajna and prajna-turiya.

In the fourth state (turiya) there is the quadruplicity of the turiya, namely turiya-vishva, turiya-taijasa, turiya-prajna (and turiya-turiya).

These in due order make up the sixteen parts.

In the letter ‘a’ (of the Om – Aum) there is jagrat-vishva, in the letter ‘u’ jagrat-taijasa, in the letter ‘m’ jagrat-prajna, in the ardha-matra (of Om) jagrat-turiya, in the bindu svapna-vishva, in the nada svapna-taijasa, in the kala svapna-prajna, in the kalatita svapna-turiya, in the shanti susupta-vishva, in the shantyatita susupta-taijasa, in pashyanti turiya-prajna, in para turiya-turiya.

The four parts of jagrat pertain to the letter ‘a’, the four parts of Svapna pertain to the letter ‘u’, the four parts of Susupti pertain to the letter ‘m’, the four parts of turiya pertain to the ardha-matra.

This is the Brahma-Pranava.
This is to be worshipped by the Paramahamsa, Turiyatita and Avadhuta ascetics.
By this Brahman is illumined.
(This is) liberation in the disembodied state (Videha-mukti).

7. continua...


Alla luce di quanto esposto finora, è abbastanza facile comprendere la sequenza dei sedici stati di coscienza che è necessario risvegliare man mano che si avanza nel proprio cammino prima di giungere alla piena Realizzazione spirituale.

Si può pertanto stilare quanto segue:

1. Esiste uno STATO DI VEGLIA (VISVA) corrispondente alla A (AKARA) di AUM, a sua volta composto da uno stato di veglia (A - visva), uno stato di sogno (U – taijasa) e uno stato di sonno profondo (M – prajna).

2. Esiste uno STATO DI SOGNO (TAIJASA) corrispondente alla U (UKARA) di AUM, a sua volta composto da uno stato di veglia (A - visva), uno stato di sogno (U – taijasa) e uno stato di sonno profondo (M – prajna).

3. Esiste uno STATO DI SONNO PROFONDO (PRAJNA) corrispondente alla M (MAKARA) di AUM, a sua volta composto da uno stato di veglia (A - visva), uno stato di sogno (U – taijasa) e uno stato di sonno profondo (M – prajna).


a) “1. STATO DI VEGLIA (VISVA)” è quello cosiddetto dei “Piccoli Misteri” ed è di carattere individuale, mentre “2. STATO DI SOGNO (TAIJASA)” e “3. STATO DI SONNO PROFONDO (PRAJNA)” sono già parte dei “Grandi Misteri” e sono di carattere universale.

b) Ognuno di questi stati principali (1. VISVA, 2. TAIJASA, 3. PRAJNA) si conclude con una realizzazione che possiamo considerare l'Ardha Matra di quello stato e che rappresenta l'Unione non definitiva con il Divino/Dio/Sé.

Anche tutti gli stati interni a ognuno di questi stati principali (A- stato di veglia, U- stato di sogno, M- stato di sonno profondo), possono dare luogo a parziali realizzazioni, che servono, primariamente, a segnalare lo stato di avanzamento coscienziale al quale si è giunti.

c) Questi tre primi stati principali corrispondono al I, II, III Buhmika o stadi di conoscenza (chi li sta esperendo è detto MUMUKSHU):

I Bhumika - corrisponde a: “1. STATO DI VEGLIA (VISVA)” ed è detto SUBHECCHA (desiderio d’illuminazione)

II Bhumika - corrisponde a: “2. STATO DI SOGNO (TAIJASA)” ed è detto VICHARANA (indagine)

III Bhumika - corrisponde a: “3. STATO DI SONNO PROFONDO (PRAJNA)” ed è detto TANUMANASA (mente tenue)

4. Esiste infine uno stato chiamato il QUARTO (TURIYA) corrispondente all'ARDHA MATRA di AUM, a sua volta composto da uno stato di veglia (A - visva), uno stato di sogno (U – taijasa), uno stato di sonno profondo (M – prajna) e uno stato di Turiya (ardha matra).


a) Nello stato “4. QUARTO (TURIYA)” si concentrano gli ultimi quattro Bhumika o stadi di conoscenza:

IV Bhumika - corrisponde a: "A - visva" ed è detto SATWAPATTI (autorealizzazione)

V Bhumika - corrisponde a: "U – taijasa" ed è detto ASAMSAKTI (non attaccamento)

VI Bhumika - corrisponde a: "M – prajna" ed è detto PADARTHABHAVANA (non percezione degli oggetti)

VII Bhumika - corrisponde a: ardha matra ed è detto TURYAGA (trascendenza)

b) Il IV Bhumika rappresenta l'AUTOREALIZZAZIONE tanto ambita: al termine dello stato TURIYA-VISVA (cioè quando si è all'ardha matra dello stato di veglia del Quarto) si è un JIVANMUKTA (liberato in vita) e un JNANI (conoscitore) a tutti gli effetti.

c) Chi si trova nel IV Bhumika è detto BRAHMAVIT, chi è nel V Bhumika è detto BRAHMAVIDVARA, chi si trova nel VI Bhumika è detto BRAHMAVIDVARIYA, mentre chi sta esperendo l'ultimo Bhumika è considerato un BRAHMAVIDVARISTHA.

d) Siccome tutti gli stati di coscienza principali si ripetono anche nel Quarto e poiché ognuno dei sottostati di AUM si ripete per ben quattro volte, è facile capire come ci si possa sbagliare e ritenersi già “arrivati” quando invece non lo si è. Di qui l'importanza di essere seguiti da chi il percorso l'ha sicuramente già esperito.

Qui si conclude questa lunga esposizione.

8 - fine.

Yati, tratto da forum pitagorico, Vedanta & Co, 11.03.2010


La parabola dei dieci sciocchi.

I dieci sciocchi della parabola guadarono un corso d'acqua e dopo aver raggiunto l'altra sponda vollero assicurarsi di aver tutti attraversato il guado senza danni. Uno dei dieci cominciò a contare, ma mentre contava gli altri lasciò fuori se stesso.

"Ne vedo solo nove; di sicuro ne abbiamo perduto uno. Chi può essere?" disse. "Hai contato bene?", chiese un altro, e cominciò a contare. Ma anch'egli ne contò solo nove.

Uno dopo l'altro ciascuno dei dieci contò solo nove, dimenticando se stesso."Siamo soltanto nove", furono tutti d'accordo; "Ma chi manca?", si chiesero. Ogni sforzo che fecero per scoprire l'individuo "mancante" fallì.

"Chiunque sia quello che è affogato", disse il più sentimentale dei dieci sciocchi, "lo abbiamo perduto". Così dicendo scoppiò in lacrime e gli altri lo imitarono.

Vedendoli piangere sulla sponda del fiume, un viandante compassionevole ne chiese loro il motivo. Essi raccontarono cos'era accaduto e dissero che persino dopo essersi contati parecchie volte non poterono contarsi più di nove. Nell'udire la loro storia, ma vedendoli tutti davanti a lui, il viandante intuì ciò che era accaduto. Al fine di far conoscere loro di essere realmente dieci e che tutti erano sopravissuti al guado, disse loro:

"Che ognuno di voi conti se stesso, ma uno dopo l'altro, in serie, uno, due, tre e così via, mentre io darò un colpo a ciascuno, così sarete sicuri di essere tutti inclusi nel conteggio...e inclusi una volta solamente. Allora il decimo uomo mancante verrà trovato".

Udendo ciò, essi si rallegrarono alla prospettiva di ritrovare il loro compagno "perduto" e accettarono il metodo suggerito dal viandante. Mentre il gentile viandante dava a turno un colpo a ognuno dei dieci, quello che veniva colpito contava se stesso ad alta voce. "Dieci", disse l'ultimo uomo mentre riceveva l'ultimo colpo. Meravigliati, si guardarono l'un l'altro. "Siamo dieci", dissero con una sole voce e ringraziarono il viandante per aver rimosso la loro angoscia.

Questa è la parabola. Da dove fu introdotto il decimo uomo? Era mai stato perduto? Venendo a sapere che egli era stato sempre là, impararono forse qualcosa di nuovo? La causa della loro angoscia non era la perdita di qualcuno, ma era la loro stessa ignoranza o, piuttosto, la semplice supposizione che uno di loro fosse stato perduto.

Tale è il tuo caso. In verità non c'è alcuna ragione per te di essere miserabile ed infelice. Tu stesso imponi delle limitazioni alla tua vera natura di essere infinito e quindi ti lamenti di essere una creatura finita. Quindi intraprendi questa o quella pratica spirituale per trascendere limitazioni inesistenti. Ma se la tua stessa pratica spirituale ammette l'esistenza delle limitazioni, come può aiutarti a trascenderle?

Sappi che tu sei realmente l'infinito puro essere, il Sè. Tu sei sempre quel Sè e nient'altro che quel Sè. Quindi non puoi mai essere realmente ignorante del Sè. La tua ignoranza è semplicemente un'ignoranza immaginaria, come l'ignoranza dei dieci sciocchi a proposito del decimo uomo perduto. È questa ignoranza che provocò la loro angoscia.

Sappi allora che la vera conoscenza non crea per te un nuovo essere, rimuove soltanto la tua ignorante ignoranza. La beatitudine non viene aggiunta alla tua natura, viene semplicemente rivelata come il tuo vero stato naturale, eterno ed immortale. Il solo modo per liberarti della tua angoscia è conoscere ed essere il Sè. Come può essere irragiungibile ciò?



[brano tratto da "Sii ciò che sei", Ramana Maharshi e il suo insegnamento, a cura di David Godman. Edizioni "Il Punto d'Incontro" pag 33-34-35]


(Upadesha Manjari)

di Ramana Maharshi

Ottava Edizione 1974 - Traduzione riveduta - Pubblicato da V. S. RAMANAN - Presidente, consiglio di amministrazione - SRI RAMANASRAMAM - TIRUVANNAMALAI (S. INDIA)

Introduzione all'edizione originale Tamil

Il mondo di lingua Tamil conosce bene la storia della vita e gli insegnamenti spirituali di Bhagavan Sri Ramana Maharshi attraverso i libri che sono già usciti. Egli splende sulla risplendente collina Arunachala (Tiruvannamalai) come il sole della conoscenza che distrugge le afflizioni di coloro che lo venerano.
In questo libro chiamato Upadesha Manjari (bouquet di insegnamenti spirituali) Sri Natanananda, un suo sincero devoto, che lo serve e ne canta le lodi ponendo ai suoi piedi di loto molte ghirlande di canti, ha pubblicato le parole del Bhagavan ascoltate da Lui in tempi diversi. Esse consistono di domande e risposte comprendenti quattro capitoli intitolati upadesha (insegnamento), abhyasa (pratica), anubhava (esperienza), e arudha (conseguimento). Chiedo umilmente ai devoti di accettare questo piccolo libro che offre un salutare cibo per lo spirito.
Viswanathan - Sri Ramanasramam, 2-2-34.


* * *


Importanza del lavoro


I. Insegnamento (Upadesa)
II. Pratica (Abhyasa)
III. Esperienza (Anubhava)
IV. Conseguimento (Arudha)

* * *


Cerco rifugio ai sacri piedi del benedetto Ramana, che adempie l'intero lavoro di creazione, preservazione e distruzione, mentre rimane completamente libero, e che ci fa rendere conto di cosa è reale e così ci protegge, che io possa presentare le sue parole in modo appropriato.

* * *


Venerando con gli strumenti (di pensiero, parola e azione) i sacri piedi di loto del Bhagavan Sri Ramana Maharshi, reale incarnazione del senza principio infinito supremo Brahman, il Satchitananda (essenza, coscienza, beatitudine), ho raccolto questo bouquet di fiori dei suoi insegnamenti (upadesamanjari) per il beneficio di coloro che sono i primi tra i ricercatori della Liberazione e che sono amati teneramente dalle persone istruite, affinché essi possano adornarsi con essi e raggiungere la salvezza.
Questo libro è una epitome delle parole immortali della grande anima, Sri Ramana Maharshi, i cui insegnamenti hanno disperso completamente i dubbi e le nozioni errate di questa umile persona proprio come il sole disperde l'oscurità. Il soggetto di questo libro è quell'eterno Brahman che splende come la vetta e il cuore di tutti i Veda e Agamas. Quella incomparabile Autorealizzazione (Atmasiddhi) che è elogiata da tutte le Upanishad e che è il supremo bene che deve essere cercato da tutti i nobili aspiranti (Brahmavids) è l'argomento di questo lavoro.


* * *



1. Quali sono le caratteristiche di un vero maestro (Sadguru)? 
Stabile permanenza nel Sé, guardando a tutto con occhio equanime, incrollabile coraggio in ogni momento, in ogni luogo e circostanza, ecc.

2. Quali sono le caratteristiche di uno studioso serio (sadsisya)? 
Un intenso desiderio per la rimozione del dolore e il conseguimento di gioia ed una intensa avversione per ogni tipo di piacere mondano.

3. Quali sono le caratteristiche dell'insegnamento (upadeśa)?
La parola "upadesa" significa: "vicino al posto o sedile" (upa=vicino, deśa=posto o sedile). Il Guru che è l'incarnazione di ciò che è indicato dai termini sat, chit e ananda (essenza, coscienza e beatitudine), previene il discepolo, che a causa della sua accettazione delle forme degli oggetti dei sensi, si è allontanato dal suo vero stato ed è conseguentemente afflitto e tormentato da gioie e dolori, dal continuare così e lo stabilisce nella sua stessa reale natura senza differenziazioni.
Upadesa significa anche il mostrare un oggetto distante come se fosse vicino. Viene cioè fatto comprendere al discepolo che il Brahman che egli crede essere distante e diverso da lui, è vicino e per nulla diverso da lui stesso.

4. Se è vero che il Guru è lo stesso Sé di un individuo, che cos'è quel principio che sta alla base della dottrina che dice che, per quanto un discepolo possa essere istruito o per quanti poteri occulti egli possa possedere, non potrà ottenere la realizzazione del sé (atma-siddhi) senza la grazia del Guru? 
Sebbene in assoluta verità lo stato del Guru sia quello del se stesso è molto duro per il Sé che è divenuto anima individuale (jiva) a causa dell'ignoranza realizzare il suo vero stato o natura senza la grazia del Guru.
Tutti i concetti mentali sono controllati dalla mera presenza del vero Guru. Se egli avesse detto ad un individuo che con arroganza si vantasse di aver visto i più remoti lidi dell'oceano del sapere o ad uno che si vantasse con arroganza di poter compiere imprese che sono quasi impossibili, "Sì, tu hai imparato tutto ciò che può essere imparato, ma hai imparato (a conoscere) te stesso? E tu che sei capace di compiere imprese pressoché impossibili, hai visto te stesso?", essi chinerebbero le teste (vergognosamente) e resterebbero in silenzio. Così è evidente che solo attraverso la grazia del Guru e non attraverso altri adempimenti è possibile conoscere se stessi.

5. Qual è il significato della grazia del guru?
Essa va oltre le parole e i pensieri.

6. Se è così, com'è che è stato detto che il discepolo realizza il suo vero stato attraverso la grazia del Guru? 
E' come un elefante che si sveglia vedendo un leone nei suoi sogni. Così come l'elefante si sveglia alla sola vista del leone, allo stesso modo è certo che il discepolo si sveglierà dal sonno dell'ignoranza nella veglia della vera conoscenza attraverso il benevolo sguardo di grazia del Guru.

7. Qual è il significato del detto che la natura del vero Guru è quella del Signore Supremo (Sarvesvara)? 
Nel caso dell'anima individuale che desideri raggiungere lo stato di vera conoscenza o lo stato di Divinità (Isvara) e con quell'obbiettivo pratichi sempre la devozione, quando la devozione individuale avrà raggiunto uno stadio di maturazione, il Signore che è il testimone di quell'anima individuale e identico ad essa, si manifesta in forma umana con l'aiuto di sat-chit-ananda, le sue tre caratteristiche naturali, e con nome e forma che egli assumerà anche benevolmente, e con il fatto di benedire il discepolo, lo assorbe in Se stesso. In accordo con questa dottrina il Guru può veramente essere chiamato il Signore.

8. Come ha fatto allora qualche grande persona a raggiungere la conoscenza senza il Guru?
Per un piccolo numero di persone il Signore brilla come luce di consapevolezza e impartisce consapevolezza della verità.

9. Qual è il fine della devozione (bhakti) e del sentiero di Siddhanta (Sarva Siddhanta)? 
E' di imparare la verità che tutte le azioni compiute da un ente con devozione disinteressata, con l'aiuto dei tre strumenti purificati (corpo, parola e mente), nella capacità del servitore del Signore, diventano azioni del Signore, e per restare saldi liberi dal senso di "io" e "mio". Questa è anche la verità di ciò che il Sarva-Siddhantis chiama para-bhakti (devozione suprema) o del vivere al servizio di Dio (irai-pani-nittral).

10. Qual è il fine del sentiero della conoscenza (jnana) o Vedanta?
E' di conoscere la verità che l' "io" non è diverso dal Signore (Isvara) e per essere liberi dal sentimento di essere l'agente (kartrtva, ahamkara).

11. Come può essere detto che il fine di entrambi questi sentieri è lo stesso? 
Qualunque cosa comporti, la distruzione del senso di "io" e "mio" è la meta, ed essendo essi interdipendenti, la distruzione di uno dei due causa la distruzione dell'altro; perciò al fine di ottenere quello stato di Silenzio che è al di là di pensiero e parola, uno dei due, il sentiero della conoscenza che rimuove il senso di "io" o il sentiero della devozione che rimuove il senso di "mio", sarà sufficiente. Quindi non vi è alcun dubbio che il fine dei sentieri di devozione e conoscenza è uno e lo stesso.

Fintanto che l'"io" esiste è necessario accettare anche il Signore. Se qualcuno desiderasse riguadagnare facilmente il supremo stato di identità (sayujya) ora perso per lui, è soltanto consono che egli abbia ad accettare questa conclusione.

12. Qual è il significato dell'ego?
L'anima individuale nella forma dell' "io" è l'ego. Il Sé che è della natura dell'intelligenza (chit) non possiede alcun senso di "io". Né il corpo insenziente possiede un senso di "io". La misteriosa apparenza di un ego ingannevole esistente tra l'intelligenza e l'insenziente, attualmente causa prima di tutti questi problemi, dopo la sua distruzione per mezzo di qualsiasi causa, che però realmente esista, verrà vista così com'è. Questa è chiamata Liberazione (moksha).


* * *



1. Che cos'è il metodo di pratica? 
Poiché il Sé di una persona che cerca di raggiungere l'Autorealizzazione non è diverso da lui e poiché non esiste null'altro uguale o superiore a lui che egli possa ottenere, essendo l'Autorealizzazione solo la realizzazione della natura stessa di un ente, il ricercatore della Liberazione realizza, senza dubbi o concetti erronei, la sua vera natura distinguendo l'eterno dal transeunte, e non devia mai dal suo stato naturale. Questa è conosciuta come la pratica della conoscenza. Questa è l'indagine che conduce all'Autorealizzazione.

2. Può questo sentiero di indagine essere seguito da tutti gli aspiranti?
Esso è adatto solo per le anime mature. Gli altri dovranno seguire metodi diversi che si adeguino allo stato della loro mente.

3. Quali sono gli altri metodi? 
Essi sono: (I) stuti, (II) japa, (III) dhyana, (IV) yoga,(V) jnana, ecc.
(I) stuti è cantare le lodi del Signore con un grande sentimento di devozione.
(II) japa è pronunciare i nomi di Dio o i sacri mantra come l'Om o mentalmente o verbalmente. (Mentre si seguono i metodi di stuti e japa la mente sarà qualche volta concentrata (lett. Chiusa) e qualche volta diffusa (lett. aperta). Le bizzarrie della mente non saranno evidenti a coloro che seguono questi metodi).
(III) dhyana significa la ripetizione dei nomi, ecc., mentalmente (japa) con sentimenti di devozione. In questo metodo lo stato della mente sarà compreso facilmente. Poiché la mente non diverrà concentrata e diffusa simultaneamente. Quando qualcuno è in dhyana non è in contatto con gli oggetti dei sensi, e quando è in contatto con gli oggetti non è in dhyana. Quindi coloro che sono in questo stato possono osservare le divagazioni della mente di qua e di là e fermando la mente dal pensare altri pensieri, fissarla in dhyana. Perfezione in dhyana è lo stato di dimorare nel Sé (lett. Dimorare nella forma di "quello" tadakaranilai). Poiché la meditazione funziona alla sorgente della mente in un modo estremamente sottile non è difficile percepire il suo alzarsi ed abbassarsi.
(IV) yoga: La sorgente del respiro è la stessa di quella della mente; perciò l'abbassarsi di uno dei due porta facilmente a quello dell'altro. La pratica di placare la mente attraverso il controllo del respiro (pranayama) è chiamata yoga. Fissando la loro mente sui centri psichici come il sahasrara (lett. Il loto dai mille petali) gli yogi rimangono per tutto il tempo che desiderano senza coscienza dei loro corpi. Per tutto il tempo in cui questo stato continua essi sembrano essere immersi in un qualche tipo di gioia. Ma quando la mente che era divenuta tranquilla emerge (diviene nuovamente attiva) riprende i suoi pensieri mondani. E' quindi necessario allenarla con l'aiuto di pratiche come dhyana, ogni qualvolta che venga esternata. Perverrà così ad uno stato in cui non vi sarà più né abbassarsi né alzarsi.
(V) jnana è l'annichilimento della mente che è stato prodotto per assumere la forma del Sé attraverso la costante pratica di dhyana o dell'indagine (vichara). L'estinzione della mente è lo stato in cui vi è una cessazione di tutti gli sforzi. Coloro che sono stabiliti in questa condizione non devieranno mai dal loro vero stato. I termini "silenzio" (mouna) e inazione si riferiscono soltanto a questo stato.

(1) Tutte le pratiche vengono seguite solo con lo scopo di concentrare la mente. Poiché tutte le attività mentali come il ricordare, il dimenticare, il desiderare, l'odiare, l'accettare, lo scartare, ecc., sono modificazioni della mente, non possono essere il vero stato di un ente. Semplicemente, l'essere privo di modificazioni è la vera natura di ognuno. Quindi il conoscere la verità dell'esistenza di un ente e l'esserla, è noto come la liberazione dalla schiavitù e la distruzione del problema (granthi nasam). Fino a che non si è stabilmente raggiunto lo stato di tranquillità della mente, la pratica della costante sottomissione al Sé e il tenere la mente incontaminata dai vari pensieri, è essenziale per un aspirante.
(2) Sebbene le pratiche per ottenere forza di volontà siano numerose, tutte quante ottengono lo stesso fine. Per questo può essere visto che chiunque concentri la propria mente su un qualsiasi oggetto, rimarrà in definitiva, alla fine di tutti i concetti mentali, meramente come quell'oggetto. Questa è chiamata meditazione di successo (dhyana siddhi). Coloro che seguono il sentiero dell'indagine realizzano che la mente che rimane alla fine dell'indagine è Brahman. Coloro che praticano la meditazione realizzano che la mente che rimane alla fine della meditazione è l'oggetto delle loro meditazioni. Poiché il risultato è il medesimo in entrambi i casi è dovere dell'aspirante praticare continuamente uno dei due di questi metodi fino a che il traguardo non sia raggiunto.

4. Lo stato di "essere in silenzio" è uno stato di sforzo o senza sforzo? 
Non è uno stato di indolenza senza sforzo. Tutte le attività mondane che sono ordinariamente chiamate di sforzo sono compiute con l'aiuto di una porzione della mente e con frequenti pause. Ma l'atto di comunione con il Sé (atma vyavahara) o del rimanere intimamente silenzioso è di intensa attività che è compiuta con la totalità della mente e senza pause.
Maya (illusione o ignoranza) che non può essere distrutta da nessun altro atto viene distrutta completamente da questa intensa attività che è chiamata "silenzio" (mouna).

5. Qual è la natura di maya?
Maya è ciò che ci fa guardare come non esistente al Sé, la Realtà, che è sempre e ovunque presente, onnipervadente e autoilluminante, e come esistenti l'anima individuale (jiva), il mondo (jagat), e Dio (para) che sono stati definitivamente dimostrati essere non esistenti in nessun tempo e luogo.

6. Dato che il Sé brilla in modo completo per sua stessa natura perché generalmente non viene riconosciuto come gli altri oggetti del mondo da tutte le persone? 
Ovunque vengano riconosciuti degli oggetti è il Sé che ha conosciuto se stesso nella forma di quegli oggetti. Per cui ciò che è conosciuto come conoscenza o consapevolezza è soltanto l'evidenza del Sé (atma shakti). Il Sé è il solo oggetto senziente. Non esiste nient'altro al di fuori del Sé. Se esistono simili oggetti essi sono tutti insenzienti e quindi non possono conoscere se stessi o riconoscersi mutualmente uno con l'altro. E' a causa del fatto che il Sé non riconosce la sua vera natura in questo modo che gli sembra di essere immerso e di dibattersi nell'oceano di nascita (e morte) nella forma dell'anima individuale.

7. Sebbene il Signore sia onnipervadente sembra che, a causa di passaggi come "adornandolo attraverso la Sua grazia", egli possa essere conosciuto solo attraverso la Sua grazia. Come può allora l'anima individuale ottenere l'autorealizzazione con i suoi sforzi senza la Grazia del Signore?
Poiché il Signore significa il Sé e poiché Grazia significa la presenza del Signore o rivelazione, non esiste attimo in cui il Signore rimanga inconosciuto. Se la luce del sole è invisibile per il gufo è soltanto colpa di quell'uccello e non del sole. Similarmente può l'inconsapevolezza di persone ignoranti del Sé, che è sempre di natura consapevole, essere altrimenti che colpa loro? Come può essere colpa del Sé? E' a causa del fatto che la Grazia è parte della vera natura del Signore che Egli è ben noto come "la Grazia benedetta". Perciò il Signore, la cui stessa natura è Grazia, non ha bisogno di concedere la Sua Grazia. Né esiste un particolare momento per concedere la Sua Grazia.

8. Quale parte del corpo è dimora del Sé?
Viene generalmente indicato il cuore sulla parte destra del torace. Ciò perché noi abitualmente puntiamo (il dito) sulla parte destra del torace quando ci riferiamo a noi stessi. Qualcuno dice che il sahasrara (il loto dai mille petali) è la dimora del Sé. Ma se questo fosse vero la testa non potrebbe cadere in avanti quando ci viene sonno o sveniamo.

9. Qual è la natura del cuore?
I sacri testi che lo descrivono dicono:
Tra i due seni, sotto il torace e sopra l'addome, vi sono sei organi di diversi colori*. Uno di essi somigliante al bocciolo di un giglio d'acqua e situato due dita sulla destra è il cuore. Esso è rovesciato; all'interno di esso vi è un minuscolo orifizio che è sede di densa oscurità (ignoranza) piena di desideri. Tutti i nervi psichici (nadis) dipendono da esso. E' la sede della forza vitale, della mente e della luce (della coscienza). (vedere Appendice alla Realta in Quaranta Versi 18-19). 

(*Questi non sono la stessa cosa dei cakra.) 

Ma, sebbene sia descritto in questo modo, il significato della parola cuore (hrdayam) è il Sé (atman). Poiché è definito dai termini esistenza, coscienza, beatitudine, eterno e pieno (sat, chit, anandam, nityam, purnam) non possiede differenziazioni come esterno ed interno o alto e basso. Questo tranquillo stato in cui tutti i pensieri giungono al termine è chiamato stato del Sé. Quando viene realizzato come è, non c'è più scopo di discussione sul fatto che sia dentro il corpo o fuori.

10. Perché sorgono nella mente pensieri di molti oggetti anche quando non vi sono contatti con gli oggetti esterni? 
Tutti questi pensieri sono dovuti a tendenze latenti (purva samskaras). Essi appaiono soltanto alla coscienza individuale (jiva) che ha dimenticato la sua vera natura e vengono esternati. In qualunque momento vengono percepiti pensieri particolari, l'indagine "Chi li sta vedendo?" dovrebbe essere fatta; essi allora scompariranno immediatamente.

11. Come possono i tre fattori (conoscitore, conosciuto e conoscenza), che sono assenti nel sonno profondo, samadhi, ecc., manifestarsi nel Sé (nello stato di veglia e sogno)? 
Dal Sé sorgono in successione:

(I) Chidabhasa (coscienza riflessa) che è un tipo di luminosità.
(II) Jiva (coscienza individuale) o il veggente o il primo concetto.
(III) Fenomeni, che è il mondo.

12. Dal momento che il Sé è libero dalle nozioni di conoscenza e ignoranza come può essere che si dica che pervade l'intero corpo nella forma della facoltà di sentire o per impartire facoltà di sentire ai sensi? 
L'uomo saggio dice che vi è una connessione tra la sorgente dei vari nervi psichici ed il Sé, che questa è il nodo del cuore, che la connessione tra il senziente e l'insenziente esisterà fintanto che venga fatta a pezzi con l'aiuto della vera conoscenza, che come la sottile ed invisibile forza dell'elettricità viaggia attraverso i fili e fa molte cose meravigliose, così pure la forza del Sé viaggia attraverso i nervi psichici e, pervadendo l'intero corpo, impartisce facoltà di sentire ai sensi, e che se questo nodo viene tagliato il Sé rimarrà come è sempre stato, senza alcun attributo.

13. Come può esistere una connessione tra il Sé che è pura conoscenza e i tre fattori che sono conoscenza relativa?
Questo avviene, in poche parole, come nel processo cinematografico come mostrato di seguito:

Spettacolo cinematografico. --> Sé.

1. La lampadina dentro la macchina da presa. --> 1. Il Sé.

2. La lente di fronte alla lampadina. --> 2. La mente pura (sattvica) vicino al Sé.

3. Il film che è una lunga serie di fotogrammi. --> 3. La corrente di tendenze latenti fatta di pensieri sottili.

4. Le lenti, la luce che passa attraverso esse e la lampadina, che insieme formano la luce focalizzata. --> 4. La mente, l'illuminazione di essa ed il Sé, che insieme formano il veggente o il jiva.

5. La luce che passa attraverso le lenti e che cade sullo schermo. --> 5. La luce del Sé che emerge dalla mente attraverso i sensi e che cade sul mondo.

6. I vari tipi di immagini che appaiono nella luce dello schermo. --> 6. Le varie forme e nomi che appaiono come oggetti percepiti nella luce del mondo

7. Il meccanismo che mette il film in moto. --> 7. La legge divina che manifesta le tendenze latenti della mente.

Così come le immagini appaiono sullo schermo per tutto il tempo in cui il film getta ombre attraverso le lenti, allo stesso modo il mondo fenomenico continuerà ad apparire all'individuo nello stato di veglia e di sonno per tutto il tempo in cui vi siano impressioni mentali latenti. Così come le lenti ingrandiscono il minuscolo punto sul film in un enorme formato e come un numero di immagini viene mostrato in un secondo, così la mente ingrandisce le tendenze simili a germogli in pensieri simili ad alberi e mostra in un secondo innumerevoli mondi. E ancora, così come vi è solo una lampadina quando non c'è il film, così soltanto il Sé splende senza i tre fattori quando i concetti mentali in forma di tendenze sono assenti nello stato di sonno profondo, svenimento e samadhi. Così come la lampada illumina le lenti, ecc. pur rimanendo intoccata, il Sé illumina l'ego (chidabhasa), ecc. pur restando intoccato.

14. Che cos'è dhyana (meditazione)? 
E' dimorare nel Sé senza deviare in nessun modo dalla propria reale natura e senza la sensazione che uno stia meditando. Poiché un ente non è minimamente cosciente dei differenti stati (risveglio, sogno, ecc.) in questa condizione, il sonno (rilevante) qui è anche considerato come dhyana.

15. Qual è la differenza tra dhyana e samadhi?
Dhyana è ottenuta attraverso un deliberato sforzo mentale; nel samadhi non vi è alcun tipo di sforzo.

16. Quali sono i fattori da tenere sempre presenti in dhyana?
E' importante per colui che è stabilito nel suo Sé (atma nista) rendersi conto che non deve minimamente deviare da questo assorbimento. Deviando infatti dalla sua vera natura egli può vedere davanti a sé chiare luminescenze, ecc. o sentire suoni (inusuali) o guardare come reale la visione degli dei che appaiono dentro o fuori di sé. Egli non dovrebbe lasciarsi ingannare da tutto ciò e dimenticare se stesso.

(I) Se i momenti che vengono sprecati nel pensare agli oggetti che non sono il Sé, venissero spesi nell'indagare il Sé, l'autorealizzazione verrebbe ottenuta in un tempo molto breve.
(II) Fintanto che la mente non venga stabilizzata in se stessa qualche tipo di bhavana (contemplazione di un dio o di una dea personificata con emozione profonda e sentimento di religiosità) è essenziale. Altrimenti la mente verrà frequentemente assalita da pensieri ribelli o dal sonno.
(III) Senza spendere tutto il tempo nel praticare bhavanas come "Io sono Shiva" o "Io sono Brahman", che sono visti come nirgunopasana (contemplazione del Brahman senza attributi), il metodo di indagine in se stessi dovrebbe essere praticato non appena la forza mentale che è il risultato di questo upasana (contemplazione) non sia stato ottenuto.
(IV) L'eccellenza della pratica sta nel non dare spazio neppure ad un singolo concetto (vritti). 

17. Quali sono le regole di condotta che un aspirante (sadhaka) dovrebbe seguire?
Moderation in food, moderation in sleep and moderation in speech.

18. Per quanto tempo si dovrebbe praticare? 
Fintanto che la mente non abbia ottenuto facilmente il suo naturale stato di libertà dai concetti, che è quando il senso di "io" e "mio" non esistono più.

19. Qual è il significato del vivere in solitudine (ekanta vasa)?
Poiché il Sé è onnipervadente non possiede un particolare luogo per la solitudine. Lo stato di essere libero dai concetti mentali è chiamato "vivere in solitudine".

20. Qual è il segno della saggezza (viveka)? 
La sua bellezza risiede nel rimanere libero dalla delusione dopo aver realizzato la verità per una volta. C'è paura soltanto in colui che vede una qualche minima differenza nel Supremo Brahman. Fintanto che esiste l'idea che il corpo sia il Sé nessuno può essere un realizzatore della verità per quanto sia forte.

21. Se ogni cosa avviene in accordo con il karma (prarabdha: il risultato delle azioni passate) come può uno superare gli ostacoli della meditazione (dhyana)?
Prarabdha riguarda solo la mente rivolta all'esterno, non la mente rivolta all'interno. Colui che ricerca il suo vero Sé non dovrà temere alcun ostacolo.

22. L'ascetismo (sanyasa) è una delle condizioni essenziali per una persona per divenire stabilito nel Sé (atma nista)? 
Lo sforzo che uno compie per liberarsi dall'attaccamento al corpo è veramente rivolto verso il dimorare nel Sé. Soltanto la maturità di pensiero e di indagine rimuove l'attaccamento al corpo, non i luoghi per vivere (asramas), come studente (brahmachari), ecc. Perchè l'attaccamento è nella mente mentre i luoghi riguardano il corpo. Come possono luoghi corporei rimuovere l'attaccamento nella mente? Dato che la maturità di pensiero e di indagine riguardano la mente questa soltanto può, indagando sulla parte della stessa mente, rimuovere gli attaccamenti che si sono insinuati in essa attraverso la sconsideratezza. Ma, poiché la disciplina dell'ascetismo (sanyasasrama) è il mezzo per ottenere distacco (vairagya), e poiché il distacco è il mezzo per l'indagine, l'entrare a far parte di un ordine di asceti può essere visto, insomma, come un mezzo per indagare attraverso il distacco. Piuttosto che sprecare la sua vita entrando nell'ordine degli asceti prima che sia pronto, è meglio che uno viva la vita del capofamiglia. Al fine di fissare la mente nel Sé che è la sua vera natura è necessario separarla dalla famiglia delle fantasie (sampkalpas) e dei dubbi (vikalpas), questo significa rinunciare alla famiglia (samsara) nella mente. Questo è il vero ascetismo.

23. E' un ordine stabilito che fintanto che vi sia la minima idea di io-sono-l'agente, non possa essere ottenuta l'Autoconoscenza, ma è possibile per un aspirante che sia capofamiglia svolgere bene i propri doveri senza questo senso? 
Dato che non c'è alcuna regola per cui l'azione debba dipendere da un senso di essere l'agente è inutile dubitare se ogni azione verrà fatta senza un agente o un atto del fare. Sebbene un ufficiale di una tesoreria di stato possa sembrare, agli occhi degli altri, che stia svolgendo il suo dovere attentamente e responsabilmente per tutto il giorno, egli starà facendo il suo dovere senza attaccamento, pensando "io non ho una reale connessione con tutto questo denaro" e senza un senso di confusione nella mente. Allo stesso modo un saggio capofamiglia può pure svolgere senza attaccamento i vari doveri familiari che ricadono sul suo destino in accordo con il suo karma passato, come uno strumento nelle mani di un altro. Azione e conoscenza non sono ostacoli l'una per l'altra.

24. Di che utilità è per la sua famiglia un saggio capofamiglia che è disinteressato ai comfort del corpo e di che utilità è la sua famiglia per lui? 
Sebbene egli sia completamente disinteressato ai comfort del corpo, se, essendo in debito con il suo karma passato, la sua famiglia deve sopravvivere attraverso i suoi sforzi, egli deve essere visto come un prestatore di servizi agli altri. Se viene chiesto se l'uomo saggio deriva qualche beneficio dal disbrigo dei doveri domestici, può essere risposto che, poiché egli ha già ottenuto lo stato di completa soddisfazione che è la somma di tutti i benefici e il supremo bene per tutti, egli non si aspetterà di guadagnare niente di più dal compimento dei doveri domestici.

25. Come possono essere ottenuti la cessazione dell'attività (nivritti) e la pace della mente nel mezzo dei doveri domestici che sono per natura di costante attività?
Poiché l'attività dell'uomo saggio esiste solo agli occhi degli altri e non ai suoi, benché egli possa compiere imprese immani, in realtà non compirà nulla. Dunque le sue attività non si associano al percorso dell'inattività e della pace della mente. Poiché egli conosce la verità che tutte le attività hanno luogo alla sua sola presenza e che egli non compie nulla. Perciò egli rimarrà il silenzioso testimone di tutte le attività che avranno luogo.

26. Così come il karma passato del Saggio è la causa delle sue attuali attività non potranno le impressioni (vasanas) causate dalle sue presenti attività attaccarglisi in futuro?
Solo colui che è libero dalle tendenze (vasanas) latenti è un Saggio. Essendo ciò allora come possono le tendenze del karma affliggere colui che è completamente intoccato dall'attività?

27. Qual è il significato di brahmacharya? 
Solo l'indagine nel Brahman potrebbe essere chiamata brahmacharya.

28. La pratica del brahmacharya che viene seguita in conformità con i (quattro) ordini di vita (asramas) sarà un segno di conoscenza? 
Poiché i vari segni di conoscenza, come il controllo dei sensi, ecc., sono inclusi nel brahmacharya le pratiche virtuose debitamente seguite da coloro che appartengono all'ordine degli studenti (brahmacharins) sono molto di aiuto per il loro miglioramento.

29. Può una persona entrare direttamente nell'ordine degli asceti (sanyasa) dall'ordine degli studenti?
Coloro che sono adatti non desiderano entrare formalmente nell'ordine dei brahmacharya, ecc., nell'ordine costituito. Uno che ha realizzato il suo Sé non distingue tra i vari ordini di vita. Quindi nessun ordine di vita lo aiuta o lo ostacola.

30. Un aspirante (sadhaka) può perdere tutto non osservando le regole di casta e degli ordini di vita?
Poiché il raggiungimento (anusthana, lett. pratica) della conoscenza è il supremo fine di tutte le pratiche, non vi è regola che uno che rimane in un qualche ordine di vita e costantemente acquisisce conoscenza sia obbligato a seguire le regole costituite per quel dato ordine di vita. Se egli segue le regole di casta e dell'ordine di vita lo fa per il bene del mondo. Egli non deriva alcun beneficio dall'osservare le regole. Né perde qualcosa nel non osservarle.


* * *



1. Che cos'è la luce della coscienza? 
E' l'autoilluminante esistenza-coscienza che rivela al veggente il mondo dei nomi e delle forme entrambi interni ed esterni. L'esistenza di questa esistenza-coscienza può essere intuita dagli oggetti illuminati da essa. Non deve divenire obbiettivo della coscienza.

2. Che cos'è conoscenza (vijnana)? 
E' il tranquillo stato di esistenza-coscienza che è sperimentato dall'aspirante e che è come l'oceano senza onde o l'etere immobile.

3. Che cos'è beatitudine? 
E' l'esperienza di gioia (o pace) nello stato di vijnana libero da ogni attività e simile al sonno profondo. Questo è anche chiamato lo stato di kevala nirvikalpa (il rimanere senza concetti).

4. Qual è lo stato oltre la beatitudine? 
E' lo stato dell'incessante pace della mente che viene trovato nello stato di assoluta quiescenza, jagrat sushupti (lett. sonno con consapevolezza) che sembra inattivo sonno profondo. In questo stato, a dispetto dell'attività del corpo e dei sensi, non vi è consapevolezza esterna, come un bambino immerso nel sonno* (che non è cosciente del cibo datogli dalla madre). Uno yogi che è in questo stato è inattivo anche quando è intento ad una attività. Questo è anche chiamato sahaja nirvikalpa samadhi (stato naturale di assorbimento nel sé senza concetti).

*Gli atti dei bambini dormienti come il mangiare ed il bere sono atti solo agli occhi degli altri e non ai loro. Essi quindi non compiono realmente questi atti a dispetto del loro apparente compierli.

5. Qual è l'autorità per dire che gli interi mondi del movimento e della assenza di movimento dipendono dal sé?
Sé significa l'incarnazione dell'essere. E' solo dopo che l'energia, che era latente nello stato di sonno profondo, emerge con l'idea di "io" che tutti gli oggetti sono sperimentati. Il Sé è presente in tutte le percezioni come il percipiente. Non esistono oggetti che possano essere visti quando l' "io" è assente. Per tutte queste ragioni può essere indubitabilmente detto che ogni cosa proviene dal Sé e ritorna al Sé.

6. Dato che i corpi e i sé che li animano sono attualmente ovunque osservati essere innumerevoli come può essere detto che il Sé è soltanto uno? 
Se viene accettata l'idea "io sono il corpo"*, i sé sono molteplici. Lo stato in cui questa idea scompare è il Sé dal momento che non esistono altri oggetti in quello stato. E' per questo motivo che il Sé e visto come uno soltanto.

*L'idea che uno sia il suo corpo è ciò che è chiamato hrdaya-granthi (nodo del cuore). Tra i vari nodi questo nodo, che lega insieme ciò che è cosciente con ciò che è insenziente, è quello che causa schiavitù. 

7. Qual è l'autorità per dire che il Brahman può essere compreso dalla mente e che allo stesso tempo non può essere compreso dalla mente? 
Non può essere compreso dalla mente impura, ma può essere compreso dalla mente pura.

8. Qual è la mente pura e quale quella impura? 
Quando l'indefinibile potere di Brahman separa se stesso da Brahman e, unito al riflesso della coscienza (chidabhasa) assume varie forme, è chiamato la mente impura. Quando diviene libero dal riflesso della coscienza (abhasa), attraverso la discriminazione, è chiamato la mente pura. Il suo stato di unione con il Brahman è la sua percezione di Brahman. L'energia che si accompagna al riflesso della coscienza è chiamato la mente impura ed il suo stato di separazione da Brahman è la sua non-percezione di Brahman.

9. E' possibile vincere, anche mentre il corpo esiste, il karma (prarabdha) che è detto durare sino alla fine del corpo? 
Sì. Se l'agente su cui pende il karma, vale a dire l'ego, che è venuto in esistenza tra il corpo ed il Sé, si immerge nella sua sorgente e perde la sua forma, sopravvivrà il karma che dipende da quello soltanto? Quindi quando non c'è "io" non c'è neppure karma.

10. Poiché il Sé è esistenza e coscienza, qual è la ragione per descriverlo come diverso dall'esistente e dal non-esistente, dal senziente e dall'insenziente?
Sebbene il Sé sia reale, poiché comprende ogni cosa, non lascia spazio alle questioni che comportano dualità sulla sua realtà o irrealtà. Quindi è detto essere diverso dal reale e dall'irreale. Allo stesso modo, anche se esso è coscienza, dal momento che non vi è nulla che debba conoscere o fare conoscere a se stesso, viene detto essere diverso dal senziente e dall'insenziente.

* * *



1. Qual è lo stato di conseguimento della conoscenza? 
E' il dimorare fermo e senza sforzo nel Sé in cui la mente che è divenuta uno con il Sé non emerge ancora in seguito mai più. Questo è, così come ognuno si rende conto abitualmente e naturalmente che, "io non sono una capra né una mucca né alcun altro animale ma un uomo", quando pensa al suo corpo, così anche quando si rende conto che "io non sono i principi (tatwas) che cominciano con il corpo e finiscono con il suono (nada), ma il Sé che è esistenza, coscienza e beatitudine", l'innata autocoscienza (atmaprajna), egli è detto aver conseguito una ferma conoscenza.

2. A quale dei sette stadi di conoscenza (jnana-bhoomikas) appartiene il saggio? 
Egli appartiene al quarto stadio.

3. Se è così perché esistono tre stadi che possono essere distinti superiori ad esso? 
I segni degli stadi da quattro a sette sono basati sull'esperienza della persona realizzata (jivanmukta). Essi non sono stadi di conoscenza e di realizzazione. Fino a che conoscenza e realizzazione hanno influenza non vi è alcuna distinzione qualsiasi cosa sia fatta in questi quattro stadi.
I sette jnana bhoomikas sono:

1. subheccha (desiderio d’illuminazione)
2. vicharana (indagine)
3. tanumanasa (mente tenue)
4. satvapatti (autorealizzazione)
5. asamśakti (non attaccamento)
6. padarthabhavana (non percezione degli oggetti)
7. turyaga (trascendenza)

Coloro che hanno conseguito i quattro ultimi bhoomikas sono detti brahmavit, brahmavidvara, brahmavidvariya e brahmavid varistha rispettivamente.

4. Dato che la liberazione è comune a tutti, perché soltanto il varistha (lett. il più eccellente) è lodato eccessivamente?
Fino a che la comune esperienza di beatitudine del varistha ha influenza egli è lodato solo a causa degli speciali meriti acquisiti nelle sue vite precedenti che sono la causa di ciò.

5. Poiché non esiste nessuno che non desideri sperimentare una costante beatitudine qual è la ragione per cui non a tutti i saggi riesce di conseguire lo stato di varistha?
Non può essere ottenuto dal puro desiderio o dallo sforzo. Il karma (prarabdha) è la sua causa. Poiché l'ego muore insieme alle sue cause già nei quattro stadi (bhoomika), quale agente rimane oltre quel livello per desiderare qualcosa o fare sforzi? Fino a che compiranno sforzi non saranno saggi (jnanis). Forse che le sacre scritture (sruti) con una menzione speciale per il varistha dicono che gli altri tre sono persone non illuminate?

6. Dato che qualche testo sacro dice che lo stato supremo è quello in cui gli organi dei sensi e la mente sono completamente distrutti, come può quello stato essere compatibile con l'esperienza del corpo e dei sensi? 
Se ciò è avvenuto non dovrebbero più esserci differenze tra quello stato e lo stato di sonno profondo. Inoltre come si può dire che sia lo stato naturale quando esiste una volta e l'altra no? Ciò accade a qualche persona, come si è detto prima, in accordo con il suo karma (prarabdha) per qualche tempo o sino alla morte. Non può essere visto esattamente come lo stato finale. Se così fosse ciò significherebbe che tutte le grandi anime ed il Signore, che sono stati gli autori dei lavori Vedantici (jnana granthas) e dei Veda, sono stati persone non illuminate. Se lo stato supremo è quello in cui né i sensi né la mente esistono e neppure lo stato in cui essi esistono come potrebbe essere lo stato perfetto (paripurnam)? Poiché soltanto il karma è responsabile dell'attività o dell'inattività dei saggi, le grandi anime hanno decretato essere lo stato ultimo soltanto quello di sahaja nirvikalpa (lo stato naturale senza concetti).

7. Qual è la differenza tra sonno ordinario e sonno cosciente (jagrat sushupti)? 
Nel sonno ordinario non solo non vi sono pensieri, ma neppure consapevolezza. Nel sonno cosciente c'è soltanto consapevolezza. Questo è il motivo per cui è chiamato cosciente sebbene dormiente, questo è il sonno in cui c'è consapevolezza.

8. Perchè il Sé è descritto in entrambi i modi, come quarto stato e come oltre il quarto stato (turiyatita)? 
Turiya significa che quello è il quarto. Gli sperimentatori (jivas) dei tre stati di veglia, sogno e sonno profondo, conosciuti come visva, taijasa e prajna, che vagano in successione in questi tre stati, non sono il Sé. E’ con l'obbiettivo di rendere ciò chiaro, vale ad dire che il Sé è ciò che è diverso da essi e che è testimone di quegli stati, che esso è chiamato il quarto (turiya). Quando questo viene compreso i tre sperimentatori scompaiono e l'idea che il Sé è il testimone, che è il quarto, pure scompare. Questo è il motivo per cui il Sé viene descritto come oltre il quarto (turiyatita).

9. Qual è il beneficio derivato al saggio dalle sacre scritture (srutis)? 
Per il saggio che è l'incarnazione delle verità menzionate nelle scritture esse non hanno utilizzo.

10. Vi è qualche connessione tra il conseguimento dei poteri supernaturali (siddhis) e la Liberazione (mukti)? 
Soltanto l'indagine illuminata conduce alla Liberazione. I poteri supernaturali sono tutti apparenze illusorie create dal potere di maya (mayashakti). L'autorealizzazione che è permanente è il solo vero talento (siddhi). I talenti che appaiono e scompaiono, essendo effetti di maya, non possono essere reali. Essi sono compiuti con l'obbiettivo di raggiungere fama, piaceri, ecc. Essi compaiono spontanei in qualche persona grazie al loro karma. Sappi che l'unione con il Brahman è lo scopo reale di tutti i talenti. Questo è anche lo stato di Liberazione (aikya mukti) conosciuto come unione (sayujya).

11. Se questa è la natura della Liberazione (moksha) perché alcune scritture la collegano con il corpo e dicono che l'anima individuale può ottenere la Liberazione solo quando non ha lasciato il corpo? 
E’ soltanto se la schiavitù è reale che la Liberazione e la natura delle sue esperienze devono essere considerate. Fino a che il Sé (Purusha) ha influenza non vi è realmente schiavitù in nessuno dei quattro stati. Poiché la schiavitù è puramente un assunto verbale che si accorda con l'enfatica proclamazione del sistema Vedantico, come può la Liberazione, che dipende dalla questione della schiavitù, sorgere quando non vi è schiavitù? Senza conoscere questa verità, indagare sulla natura della schiavitù e della Liberazione, è come indagare sull'altezza, colore, ecc., del figlio di una donna sterile o sulle corna di una pecora.

12. Se è così, le descrizioni della schiavitù e della liberazione nelle scritture non diventano irrilevanti e false? 
No, non lo fanno. Al contrario, la delusione della schiavitù costruita dall'ignoranza da tempo immemorabile può essere rimossa solo dalla conoscenza, e per questo motivo il termine "Liberazione" (mukti) è stato abitualmente accettato. Questo è tutto. Il fatto che le caratteristiche della Liberazione siano descritte in modi differenti prova che esse sono immaginarie.

13. Se è così, tutti gli sforzi come lo studio (lett. l'ascoltare), la riflessione, ecc., non sono senza scopo?
No, non lo sono. La ferma convinzione che non vi sono né la schiavitù né la liberazione è lo scopo supremo di tutti gli sforzi. Poiché questo scopo di vedere arditamente, attraverso l'esperienza diretta, che schiavitù e liberazione non esistono, non può essere ottenuto eccetto che con l'aiuto delle suddette pratiche, questi sforzi sono utili.

14. Esiste qualche autorità per dire che schiavitù e liberazione non esistono? 
Questo è indotto dalla forza dell'esperienza e non solamente sulla forza delle scritture.

15. Se è sperimentato come è sperimentato? 
"Schiavitù" e "Liberazione" sono meri termini linguistici. Essi non hanno realtà di per se stessi. Poiché non possono funzionare spontaneamente, è necessario accettare l'esistenza di un qualche pensiero di base di cui essi siano la modificazione. Se uno indaga, "per chi sono schiavitù e Liberazione?" verrà visto che, "sono per me". Se uno indaga, "chi sono io?", egli vedrà che non esiste un pensiero come l'"io". Sarà allora così chiaro come un frutto di amalaka nella mano di uno che ciò che rimane è l'essere reale di costui. Poiché questa verità sarà naturalmente e chiaramente sperimentata da coloro che lasciano da parte le mere discussioni verbali e indagano su loro stessi intimamente, non vi è dubbio che tutte le persone realizzate uniformemente non vedranno né schiavitù né Liberazione fino a che il Sé avrà influenza.

16. Se veramente non esistono né schiavitù né Liberazione qual è la ragione per l'attuale esperienza di gioie e dolori?
Essi sembrano essere reali solo quando uno si allontana dalla sua reale natura. Essi non esistono realmente.

17. E' possibile per chiunque conoscere direttamente senza dubbio che cosa sia la vera natura individuale? 
Indubitabilmente è possibile.

18. Come? 
E’ l'esperienza di chiunque che anche negli stati di sonno profondo, svenimento, ecc., quando l'intero universo, in movimento e stazionario, cominciando dalla terra e finendo con l'immanifesto (Prakriti), scompare, egli non scompare. Quindi lo stato di puro essere che è comune a tutti e che è sempre sperimentato direttamente da ognuno è la vera natura individuale. La conclusione è che le esperienze nello stato illuminato così come in quello ignorante, che possono essere descritte nuovamente e con nuove parole, sono opposte alla reale natura individuale.


* * *

Possa questo libro che è composto dalle parole dell'esperienza, che è fiorito dal cuore di loto del Bhagavan Sri Ramana Maharshi, brillare come una lampada di vera conoscenza per illuminare proprio le menti di coloro che hanno rinunciato (al mondo).

* * *


Possa il mondo essere benedetto a lungo dai piedi del Guru Ramana che dimora come quel silente principio che assorbe tutti noi e rimane se stesso come la radice dei tre principi (anima, mondo e Isvara).

* * *



«Chi è il veggente? Quando cercai dentro, vidi la scomparsa del veggente e ciò che vi sopravviveva. Non sorse il pensiero ‘io vidi’; come dunque poteva sorgere il pensiero ‘io non vidi’?
Chi ha il potere di esprimere ciò a parole, quando pure Tu, (apparendo come Dakshinamurti), nei tempi antichi hai potuto farlo solo con il silenzio?
Ed è solo per esprimere il Tuo Stato con il silenzio che Ti ergi come una Montagna splendente dal cielo alla terra» .

Di Arunachala, i Purana shaiva narrano di una disputa sorta fra Brahma e Vishnu su chi fosse il più grande. Si racconta che, poiché tale disputa si era presto trasformata in uno scontro che stava devastando l’universo, Shiva si manifestò fra loro sotto le sembianze di un’enorme colonna di fuoco. I due contendenti, sorpresi, decisero che chi avesse trovato la fine della colonna sarebbe stato il più grande. Vishnu assunse la forma del verro (cinghiale maschio) Varaha e iniziò a scavare giù, attraverso i mondi inferiori, mentre Brahma prese la forma di un cigno e si involò verso l’alto. Vishnu arrivò sino al quarto mondo inferiore, ma la fine della colonna non era nemmeno lì, così si arrese e tornò indietro.

Nemmeno Brahma riuscì a raggiungere la sommità, ma raccolto un fiore caduto dal paradiso affermò di averlo colto sulla sommità.

In questo mito Shiva, il Distruttore, è il Sé e distrugge l’illusione di un’esistenza individuata; Vishnu, il Preservatore, è il senso dell'io e preserva l'esistenza apparentemente separata, unendo tutti i suoi momenti in un insieme apparente. Scava dentro se stesso, cercando invano di Essere.
Brahma, il Creatore, è la mente quando assume la funzione creativa e vola alta, fra idee e teorie, e se anche riceve un'intuizione dal paradiso erroneamente si crede illuminata.

Quando Shiva si mostrò [con la sua forma] benedisse Vishnu per la sua verità e devozione e condannò Brahma, per l’offesa, a non avere dedicato alcun tempio. Effettivamente i templi indiani sono prevalentemente dedicati a Shiva e Vishnu.
Sono i Purana stessi a sostenere che allora Brahma aveva un’ulteriore quinta testa sporgente sopra le quattro con cui viene raffigurato, che venne recisa dallo stesso Shiva.

“La quinta testa di Brahma è la quintessenza oltre i quattro elementi, il centro oltre le direzioni dello spazio, la pura conoscenza che trascende la conoscenza relativa della mente e dei sensi. È l'equivalente del terzo occhio di Shiva, la conoscenza unitaria che sottende la dualità. La sua recisione è la caduta dell'uomo secondo la tradizione cristiana: l’uomo, privato della conoscenza diretta del paradiso precipita nel mondo degli opposti, il mondo del bene, del male e del conflitto tra loro.
Si narra che Vishnu intervenne e pregò il Signore Shiva, ricordandogli che Brahma è il Dio dei quattro Veda (le sue quattro facce) e che questi non sono costituiti da meri concetti, ma sono il suono originario, di base, da cui l'universo è creato ed è tenuto in essere. Pertanto se il Dio dei Veda fosse stato distrutto, anche l'universo si sarebbe sbriciolato cadendo in rovina.
Śambhu [il Benefico: epiteto di Shiva] rispose che Brahma restava ancora il Dio dei Veda e che in qualunque luogo, i Veda fossero stati salmodiati, quello sarebbe stato il suo tempio.
Allora Vishnu e Brahma, pregarono Shiva di ritrarre il Suo splendore lasciando che la colonna di fuoco assumesse la forma di una inerte collina per l’eterna e continua benedizione del mondo.
Fu così che il Signore Shiva, ascoltando con misericordia le loro preghiere, ritrasse il suo splendore nella collina di Arunachala per la benedizione di coloro che la visitano. Ogni anno, durante la festa di Kartikai, un fuoco sacro alimentato col ghee (burro chiarificato), donato dai devoti, viene acceso sulla sommità di Arunachala come simbolo della sua reale natura di puro fuoco.”


brano tratto da La Via della Montagna, vol. 1 - luglio 1964, n. 3 La Mitologia di Arunachala Di T. K. S.


Chi è online

Abbiamo 61 visitatori e nessun utente online